KEGG   Christensenella minuta: B1H56_13155Help
Entry
B1H56_13155       CDS       T05665                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cmiu  Christensenella minuta
Pathway
cmiu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cmiu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B1H56_13155
Enzymes [BR:cmiu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     B1H56_13155
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     B1H56_13155
    1.1.1.-  
     B1H56_13155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AYH41385
Position
2728149..2729189
Genome map
AA seq 346 aa AA seqDB search
MKSLAIEKNYTLNLIDIPVPQIDRSSALVKIHGCGICGTDMKIVHGTFKEFETYPCLLGH
EAVGEVVEVGSDVTAFKEGDKVLLPYLEGEIDGYIPSHGAFSEYGICHDIIAMAKEGRGP
DSPGFNELFYPQKKVPDDFDTECGVMMVTLREVLAATRHFGFTAGQSLVVFGGGAVGLSF
VKFAKLIGMAPVILVDIMDEKVDDAKYIGADYALNSMKSDIVSEIRKLCPQGVDYTLDAV
GVNELISQSMQLICRGGKILIYGISPVVSMQFDWTLAPDNWSLDFFWAPDKILESAVHDQ
LVQWISMGIVNPYDFISHTFAYADIMKAFDVLEQKKPAKKIIVKMT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtttagccatagaaaaaaattatactctaaacctcattgacatccctgttcct
caaatcgatagaagcagtgcccttgttaaaatacatggctgtggcatctgtggcacagat
atgaagatcgttcatgggacatttaaagaatttgagacatatccatgtttgcttggacat
gaggcagtaggtgaagttgtagaggtcggaagtgatgtaacagcttttaaagaaggcgat
aaagtattgcttccttatttggaaggtgagattgatggatatattccttcgcatggcgct
ttttcagagtacgggatttgtcacgatatcattgctatggccaaagaagggagaggcccg
gattcccctggattcaatgaactgttttatccgcagaaaaaagtaccagatgattttgac
actgaatgtggggttatgatggtaaccttgcgtgaggttctagctgccacacggcacttt
gggtttacagctggtcaaagcttagtagtatttggcggtggagcggttggtttatcattt
gtaaaatttgcaaagcttatcgggatggcgccagtcattttggtcgatattatggacgaa
aaagtcgatgatgcaaaatatataggtgcagattatgctcttaatagtatgaaaagcgat
attgtgagcgaaatacgcaagttatgtccgcaaggtgtagattatacgcttgatgcagtt
ggggtaaacgaattgatttcccagtctatgcagcttatttgccggggagggaaaattcta
atatatggaatttcaccagtggtatcgatgcagtttgattggacattagcgccagataat
tggtcgttggatttcttttgggcaccagacaagattttagaatcggccgtacacgatcag
ttagtgcagtggatatcaatgggaattgtgaatccatatgattttatttcccacacattt
gcatacgcagacattatgaaggcgtttgatgttctggagcaaaagaaacccgccaaaaag
attatagtaaaaatgacataa

DBGET integrated database retrieval system