KEGG   Cronobacter malonaticus LMG 23826: AFK66_000145Help
Entry
AFK66_000145      CDS       T04062                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00860  Porphyrin and chlorophyll metabolism
cmj01100  Metabolic pathways
cmj01110  Biosynthesis of secondary metabolites
Module
cmj_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AFK66_000145
Enzymes [BR:cmj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     AFK66_000145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C MerR-DNA-bind Tox-REase-2
Motif
Other DBs
NCBI-ProteinID: ALX80459
Position
complement(4079372..4080745)
Genome map
AA seq 457 aa AA seqDB search
MSEQVIDWDLALIQKYNYSGPRYTSYPTALEFSETFGEPDFARAVARYPDRPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDVLEQEIIHRAPLFAGRHISQLHWGGGTPTYLSK
AQISRLMGLLRANFRFNDDAEISIEVDPREIELDVLDHLHAEGFRRLSMGVQDFNKEVQR
LVNREQDEDFIFALIKRAREVGFTSANIDLIYGLPKQTPESFAFTLQRVAELNPDRLSVF
NYAHLPTLFAAQRKIKEADLPSAQQKLDILQQTIQSLTHAGYQFIGMDHFAKPDDELAIA
QHDGVLHRNFQGYTTQGDTDLLGLGVSAISMIGDCYAQNQKELKRYYQAVDEQGNALWRG
LALTRDDCIRRDVIKALICNFRLDFAEIEKTWSLRFADYFAEDLQLLAPLAKDGLVDVNA
RGITVTAKGRLLIRNVCMCFDVYLRRKARLQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcaggtaatcgactgggatctggccctcatccagaaatataactattccggg
ccgcgctatacctcatatcccacggctcttgagttttctgaaacgtttggcgagccggac
ttcgcgcgcgcggtcgcgcgttatcccgacaggcccctctcgctctacgttcacatccct
ttctgccacaagctctgctacttctgcggctgcaataaaatcgtcacccgccagcagcat
aaagccgaccagtatctcgacgtgctggagcaggagattattcatcgcgcgccgctgttt
gccgggcgtcacatcagccagctgcactggggcggcggtacgccgacttatctcagcaaa
gcgcaaatcagccgcctgatgggcctgctgcgcgcgaatttccggttcaacgacgacgct
gaaatctccattgaagtcgacccgcgcgaaattgagctcgatgtgctggatcacctgcac
gccgaaggattccgccgtctcagcatgggcgtgcaggatttcaataaagaggtgcagcgt
ctggtgaaccgcgagcaggatgaagacttcatctttgcgctcatcaaacgcgcgcgggaa
gtgggtttcacctcggccaatatcgatttaatctacggtctgccgaagcagacgccggaa
agtttcgcctttacgctgcagcgcgtggcggaacttaacccggaccgcctgagcgtcttt
aactacgcgcacctgccgacgctctttgccgcgcagcgcaaaatcaaagaggcggatctg
ccgtcggcgcagcagaagctcgatatccttcagcagactatccagtcgctgacccacgcg
ggttatcagttcatcggtatggatcacttcgcgaagccggatgatgagctggctatcgcc
cagcatgacggcgtgctgcatcgtaacttccagggctacaccacgcagggcgacaccgat
ctgctcggcctgggcgtctcggcgattagtatgatcggcgactgctacgcgcagaaccag
aaagagcttaagcgttactatcaggcggtggatgagcagggcaatgcgctgtggcgcggg
cttgcgctgacgcgcgacgactgcatccgccgcgacgtcatcaaagcgctgatctgtaat
ttccggctcgatttcgctgagatcgagaagacgtggtcgctccgtttcgccgactatttt
gccgaagatctgcaactgctggcgccgctggcgaaagacgggctggtggacgtgaacgcg
cgcggaatcaccgtaacggcgaaagggcgtttgctgattcgcaatgtctgcatgtgcttt
gacgtctatctgcgccgcaaagcgcggctgcaacagttctcacgcgtgatataa

DBGET integrated database retrieval system