KEGG   Cronobacter malonaticus LMG 23826: AFK66_003430Help
Entry
AFK66_003430      CDS       T04062                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00071  Fatty acid degradation
cmj00280  Valine, leucine and isoleucine degradation
cmj00310  Lysine degradation
cmj00362  Benzoate degradation
cmj00380  Tryptophan metabolism
cmj00620  Pyruvate metabolism
cmj00630  Glyoxylate and dicarboxylate metabolism
cmj00640  Propanoate metabolism
cmj00650  Butanoate metabolism
cmj00900  Terpenoid backbone biosynthesis
cmj01100  Metabolic pathways
cmj01110  Biosynthesis of secondary metabolites
cmj01120  Microbial metabolism in diverse environments
cmj01130  Biosynthesis of antibiotics
cmj01200  Carbon metabolism
cmj01212  Fatty acid metabolism
cmj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK66_003430
   00630 Glyoxylate and dicarboxylate metabolism
    AFK66_003430
   00640 Propanoate metabolism
    AFK66_003430
   00650 Butanoate metabolism
    AFK66_003430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AFK66_003430
   00072 Synthesis and degradation of ketone bodies
    AFK66_003430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFK66_003430
   00310 Lysine degradation
    AFK66_003430
   00380 Tryptophan metabolism
    AFK66_003430
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AFK66_003430
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AFK66_003430
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AFK66_003430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmj04147]
    AFK66_003430
Enzymes [BR:cmj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AFK66_003430
Exosome [BR:cmj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFK66_003430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALX77394
Position
649016..650194
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGAARTPIGCFQGQLARRSAVELGAVVIEALLARTGLDPLDVDEVILGQVLTAG
AGQNPARQTALNSGLPWSVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTEGRSGAQSDSHIIDSLVHDGLWDAFNDYHMGVTAENLAREYNISREHQDAYALA
SQHKARAAIDSGRFRDEIVPVVIEQMQGAPLVVDTDEQPRANTSAEALARLSPAFDRLGS
VTAGNASSMNDGAAAVLMMSASKAQEMGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLNDVDLIEANEAFAAQTLSVGKLLEWDERKVNVNGGAIALGHPIGASGCRILVS
LVHEMVKREARKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtggtaattgtaggggccgcacgcacgcccattggctgctttcagggccag
cttgcgcgtcgctcggcggtggaactcggtgcggtggtcattgaggcgctgctggcgcgc
accggtctcgatccgctggatgtcgatgaagtgatcctgggccaggtgctgaccgcgggt
gcgggccagaacccggcgaggcagaccgcgttgaatagtggcctgccgtggtccgtttcg
gcgattaccatcaacgacgtatgcggctctggactgaaggcgctgcatctggcgacgcag
gcgattcagtgcggagaggcggatgtagtgattgccggcgggcaggagaacatgagccgc
gccccgcatgtgctgaccgaagggcgcagcggtgcgcaaagcgacagtcatatcatcgac
agcctggtgcatgacgggctgtgggacgcgtttaacgattaccacatgggcgtcacggcg
gaaaatctggcgcgtgaatataacatcagccgcgaacatcaggatgcgtacgcgcttgcg
tcgcagcataaggcgcgggcagccatcgacagcggccggtttcgtgacgagatcgtgccg
gtcgtgattgaacagatgcagggcgcgccgctggtggtggataccgacgagcagccgcgc
gctaataccagtgccgaagcgctggcgcgtctgtcgcccgctttcgatcgcctcgggagc
gtcacggcgggaaacgcttcgtcaatgaatgacggcgcggcggcggtgctgatgatgagc
gccagcaaagcacaggagatggggctgccggtgctggcgcgcattcgcgccttcgcaagc
gtgggggtcgatccggcgctgatgggcattgcgccggtctacgccacgcgccgctgtctg
gagcgcgcgggctggcagctcaatgatgttgatcttatcgaggctaatgaggcgttcgcg
gcacagacgctgtcagtcggtaagctactggagtgggacgagcgcaaggtgaatgttaac
ggcggcgcgattgcgctggggcatccgattggcgcgtctggctgccgtattctcgtctct
ctggtgcatgaaatggtaaaacgtgaagctcgcaaagggcttgccacgctatgcatcggt
ggcggacagggcgtggcgctggcgattgagcgcgattaa

DBGET integrated database retrieval system