KEGG   Cronobacter malonaticus LMG 23826: AFK66_008980Help
Entry
AFK66_008980      CDS       T04062                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00010  Glycolysis / Gluconeogenesis
cmj00071  Fatty acid degradation
cmj00350  Tyrosine metabolism
cmj00625  Chloroalkane and chloroalkene degradation
cmj00626  Naphthalene degradation
cmj00680  Methane metabolism
cmj01100  Metabolic pathways
cmj01110  Biosynthesis of secondary metabolites
cmj01120  Microbial metabolism in diverse environments
cmj01130  Biosynthesis of antibiotics
cmj01200  Carbon metabolism
cmj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFK66_008980
  09102 Energy metabolism
   00680 Methane metabolism
    AFK66_008980
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AFK66_008980
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AFK66_008980
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AFK66_008980
   00626 Naphthalene degradation
    AFK66_008980
Enzymes [BR:cmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AFK66_008980
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     AFK66_008980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Met_10 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ALX78577
Position
1932754..1933872
Genome map
AA seq 372 aa AA seqDB search
MKSRAAVAFGPGKPLEIVEIDVAPPKKGEVLVKITHTGVCHTDAFTLSGDDPEGVFPAVL
GHEGGGVVVEVGEGVTSLKPGDHVIPLYTAECGECKFCKSGKTNLCQAVRATQGKGLMPD
GTTRFSYNGEPVYHYMGTSTFSEYTVCAEISLAKVNPQAPLDKVCLLGCGVTTGIGAVHN
TAKVKEGDTVAVFGLGGIGLAVIQGAVQAKAGRILAIDTNPEKFKLAGEMGATDFVNPKD
YDKPIQDVIVEMTDGGVDFSFECIGNVNVMRAALECCHKGWGESVIIGVAGAGQEIKTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEDAMAGKIRLDPFITHRLPLEQINEAFDLMHEG
KSIRTVIHFGDK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgcagcagtcgcatttggcccgggcaaaccgctggaaatcgttgagatt
gacgtcgcgccgccgaaaaagggcgaagtgctggtcaaaattacccacaccggcgtgtgc
cacaccgatgcgttcacgctctccggcgacgatccggaaggcgtcttcccggcggtgctc
ggtcatgaaggtggcggcgtggtcgtggaagtgggcgagggcgtcaccagcctgaagccg
ggcgaccatgtgatcccgctctataccgccgaatgcggcgagtgcaaattctgtaaatcc
ggtaaaaccaacctctgccaggccgtacgcgccacgcagggcaaaggcctgatgccggac
ggcaccacccgtttctcttacaacggcgagccggtttatcactatatgggcaccagcacc
ttcagcgaatacaccgtctgcgccgagatttcgctggcgaaagtgaacccgcaggcgccg
ctcgataaagtctgcctgctgggctgcggcgtcaccaccggcatcggcgcggtgcataac
accgccaaagtgaaagagggcgacaccgttgccgtgttcggcctcggcggtattggcctt
gcggtaatccagggcgcggtacaggcgaaggccgggcgcattctggccatcgacaccaac
ccggagaaattcaagctggcgggtgaaatgggtgccaccgatttcgttaacccgaaagat
tacgacaagccgattcaggacgttatcgttgagatgaccgacggcggtgtcgatttcagc
tttgagtgcatcggcaacgtcaacgtgatgcgcgcggcgctggagtgctgccataaaggc
tggggtgaaagcgttatcatcggcgtggcgggcgcaggtcaggagatcaaaacgcgtccg
ttccagctggtgacaggccgcgtctggcgcggttcggcgttcggtggcgtgaaaggccgc
acccagctgccgggcatggtggaagacgcgatggcgggtaagattcgcctcgatcctttc
attacgcaccgcctgccgcttgagcagatcaacgaggcgttcgacctgatgcatgaaggt
aagtcgatccgcaccgttatccacttcggcgacaaataa

DBGET integrated database retrieval system