KEGG   Cronobacter malonaticus LMG 23826: AFK66_011300Help
Entry
AFK66_011300      CDS       T04062                                 

Definition
(GenBank) selenide,water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00450  Selenocompound metabolism
cmj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AFK66_011300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmj03016]
    AFK66_011300
Enzymes [BR:cmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     AFK66_011300
Transfer RNA biogenesis [BR:cmj03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    AFK66_011300
 Prokaryotic Type
    AFK66_011300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ALX78958
Position
complement(2366488..2367531)
Genome map
AA seq 347 aa AA seqDB search
MSEQAIRLTQYSHGAGCGCKISPKVLETILHSDQAKFIDPNLLVGNETRDDAAVYDLGNG
TSVISTTDFFMPIVDNPFDFGRIAATNAISDIYAMGGKPIMAIAILGWPVNTLAPEIARE
VVEGGRFACQQAGIALAGGHSIDAPEPIFGLAVTGVVPTERVKKNSTAEAGCKLFLTKPL
GIGVLTTAEKKSLLRPEHQGLATEVMCTMNKAGADFAEIDGVRAMTDVTGFGLLGHLSEV
CQGAGLQAELWYEAVPKLPGVEEYIAQGAVPGGTSRNFASYGHLMGDMPDAWRSLLCDPQ
TSGGLLLAVEPAAEAQVQAVAAQHGITLSAIGELKTARGGRPMVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaagcgattcgtctgacccagtacagccacggagcaggttgcggttgtaaa
atttccccgaaggtgctggaaaccatcctgcacagcgatcaggcgaagtttatcgacccc
aacttgcttgtcggcaacgaaacgcgcgacgacgcggcggtgtacgatctcggcaacggc
acgagcgttatcagcaccacggatttcttcatgcctatcgtggacaacccgttcgatttc
ggccgaatcgctgcgaccaacgccatcagcgacatctacgcgatgggcggcaaaccgatc
atggcgattgcgatcctcggctggccggttaacacgctcgcgccggaaatcgcgcgcgag
gtggtggaaggcgggcgctttgcgtgtcagcaggcgggcattgcgctcgcgggcggccac
tccatcgacgcgccggagccgattttcggcctggcggtcacaggcgtcgtgccgaccgaa
cgcgtgaagaaaaacagcaccgccgaggcgggctgcaaactctttctcaccaaaccgctg
ggtatcggcgtgctgaccaccgccgagaaaaaatcgctgctgcgccctgagcatcagggg
ctggcgacagaagtgatgtgcaccatgaataaagcgggcgctgatttcgcagagatcgac
ggcgtccgggcgatgacggatgtcaccggcttcgggctactgggacacctcagcgaagtg
tgccagggcgcgggcctgcaggcggagctctggtatgaggccgtgccgaaactgccaggc
gttgaagaatacatcgcgcagggcgcggtgccgggcggcaccagccgtaactttgcgagc
tacggccacctgatgggcgacatgccggacgcctggcgcagcctgctgtgcgatccgcaa
acctccggcggcctgctgctggcggtggagccagccgcagaagcgcaggtgcaggccgtg
gcggcacagcatggcatcacgcttagcgccattggcgagctgaaaaccgcgcgcggcggc
cgtccgatggtggagattcgctaa

DBGET integrated database retrieval system