KEGG   Cronobacter malonaticus LMG 23826: AFK66_016320Help
Entry
AFK66_016320      CDS       T04062                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
cmj  Cronobacter malonaticus LMG 23826
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AFK66_016320 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ALX79903
Position
3433346..3433723
Genome map
AA seq 125 aa AA seqDB search
MADSPRVCVQVQSVYIEAQSSPEDERFVFAYTVTVRNLGRTPVQLLGRYWLITNGNGKET
EVQGEGVVGVQPHIQPGGEYQYTSGAVIETPFGTMQGHYEMVDDQGNGFHLDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggctgattcaccccgcgtttgcgtacaggtacaaagcgtttatatcgaagcccagtct
tcaccggaggatgagcgtttcgtttttgcctataccgtcaccgtccgcaatctggggcga
acgcctgttcagttgctgggccgctactggcttatcaccaacggcaacggtaaagagacc
gaagtccagggtgaaggcgtggtaggggttcagccccacatccagcccggcggcgaatac
cagtacaccagcggcgcggtcattgaaacgccgttcggcacgatgcagggccactatgag
atggtggacgatcagggcaacggttttcaccttgatatcccggttttccgcctcgccgtt
cccacactgatccattaa

DBGET integrated database retrieval system