KEGG   Cronobacter malonaticus LMG 23826: AFK66_017650Help
Entry
AFK66_017650      CDS       T04062                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cmj  Cronobacter malonaticus LMG 23826
Pathway
cmj00052  Galactose metabolism
cmj00500  Starch and sucrose metabolism
cmj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFK66_017650
   00500 Starch and sucrose metabolism
    AFK66_017650
Enzymes [BR:cmj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AFK66_017650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ALX80095
Position
3652802..3654211
Genome map
AA seq 469 aa AA seqDB search
MTTRTLLPAILQAVMKGQPVALGDRHYPRWHLAPVTGLMNDPNGFIHFQGRYHLFYQWNP
LGCAHQHKCWGHWSSADLTYWQHEPLALMPDEEYDRSGCYSGSAVDDNGRLTLCYTGNVK
FDDGTRTAWQCLAVQNADGGFDKLGPVMPLPGGYTGHVRDPKVWRHGEHWYMVLGAQDLE
LQGKVLLLRSDTLWNWENLGEIAGSTLGGLGEAGYMWECPDLFMLDGKAILITCPQGVTR
EEKRYLNTYPSAYLCGDLDYDTPEFRHGPLVELDAGFEFYAPQTTLADDGRRLLIGWMGV
PDGEEMLQPTVAQGWIHQMTCPRELSLRDGKLCQQPVRELATLRGEEQRLEGVAGTLSPL
AAESLELMLEAQGDVTLDFADTLRLEWTRDGLRLSRRSLASGEWQYRYWQGDARRLHILC
DRSSVEIFINDGEGVMSSRYFPAANATLGFEGDAHLRLRYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgactacccgcacgctgctgcctgccattttacaggctgtgatgaaaggccagccggtc
gcgcttggcgatcgccactatccgcgctggcatctggccccggtgacgggcctgatgaac
gacccgaacggttttatccattttcaggggcgctaccacctgttttatcagtggaacccg
ctgggctgtgcgcatcagcataaatgctgggggcactggagttcggcggatctgacgtac
tggcaacacgagccgctggcactgatgcccgacgaagagtatgaccgcagcggctgttat
tccggcagcgcggtggatgacaacgggcggctgacgctctgctataccggcaacgtgaag
tttgacgacggcacccgcaccgcctggcagtgtctggcggtgcagaacgcggacggcggt
ttcgacaagctaggcccggtgatgccgctgcccggcggctataccggccacgtgcgcgac
ccgaaagtgtggcgtcacggcgagcactggtacatggtgctgggcgcgcaggatctggaa
ttgcagggcaaagtgctgctgctgcgctccgacactctgtggaactgggaaaacctgggc
gagatcgccggcagcacgctcggcgggcttggcgaggcgggctacatgtgggagtgcccg
gaccttttcatgctggacggcaaagcgattctgatcacctgcccgcagggggtaacgcgc
gaagaaaaacgctatctcaacacctatccgagcgcgtacctgtgcggcgatctcgattac
gacacgccggaatttcgtcatggcccgctggtggagctggacgccggctttgaattttac
gcgccgcaaaccacgctggccgacgatggccgccggttacttatcggctggatgggcgtg
ccggacggcgaagagatgttgcagccaacggtggcgcagggctggatccatcagatgacc
tgcccgcgcgaactctcgcttcgcgacggcaaactctgccagcagccggtacgcgaactt
gccacgctgcgcggcgaggaacagcgcctggagggcgtggccggcacgctctcaccactc
gcggcggaaagcctggagctgatgctggaagcgcagggcgacgtcacgctcgatttcgcc
gacaccctgcgtctcgagtggacgcgcgacggtctgcggctttcgcgccggagcctcgcc
agcggcgaatggcagtatcgctactggcagggcgacgcccgccgcctgcacattctgtgc
gaccgttccagcgttgagattttcattaacgacggcgaaggcgtgatgagcagccgctat
ttcccggcggccaacgcgacgcttggttttgaaggcgacgcgcatctccggctgcgctac
tggtcgttacgcgcctgcatggtagaatga

DBGET integrated database retrieval system