KEGG   Callorhinchus milii (elephant shark): 103172499Help
Entry
103172499         CDS       T03088                                 

Gene name
map4k4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103172499 (map4k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmk01001]
    103172499 (map4k4)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103172499 (map4k4)
Protein kinases [BR:cmk01001]
 Serine/threonine kinases: STE group
  STE20 family
   103172499 (map4k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 103172499
NCBI-ProteinID: XP_007883442
UniProt: V9K7G6
Position
Un
AA seq 1285 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNSLKEDWIAYICREILRGLAHLHVHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSLGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIESCLVKNYMQRPSTEHLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEELPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEAMRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
ILQQQLLQEQAMLLEYKWREMEEQRQAERLQRQLQQEQVYLLSLQHDQRQQERNKQPYHA
SEPKSHFEPTDRGREADERFKKSNQGSPQAQSKQSSKVLEPPVPSRSESFSNGSSEPNPT
ALHRPMESQVPVRTTPRSPVLSRRDSPLQGSSQPSAQNAARSNIEPRLLWERVEKLVPRP
GSGSSSGSSNSGSQPGSHPGSQTGSGERYRLRSSSKSEGSPSQRHENLTKKTEDKKDFRP
SRPTGEVDLAALAKELRAVEDIRPPQKVTDYSSSSDESGTTDDEDEDLDQEGTDETGPMS
DDARAISSSKLSNGETESVNTMIVHDDLELPTETSVTPSKDGTLIVRQSAGDLKRASHHE
SNGFASRIHLLPDLIQQSHSSTSPTTQQAPILSPQLPRDELTTNETQSAGSTLQKHKSSS
SFTPFIDPRLLQISPSSGSTISSVVVLSSDQIRPDSMRQDPSRKGSVVNVNPTNTRPQSD
TPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLE
GLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERI
KFLVIALKNSVEVYAWAPKPYHKFMAFKSFTDLLHKPLLVDLTVEEGQRLKVIYGSSAGF
HAVDVDSGTVYDIYLPTHIQSSIQPHAIIILPSTDGMELLVCYEDEGVYVNTYGRITKDV
VLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVF
FASVRSGGSSQVYFMTLGRSSLLSW
NT seq 3858 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactctcctgctaaaagtctggtggatatagacctctcctctctgcgggac
ccagcggggatatttgaattggttgaagtggtcggaaatggcacctatggacaagtgtac
aagggccgtcatgtcaaaacaggtcaactggcagccattaaagttatggatgttacggag
gatgaagaagaagaaattaaactggagatcaatatgctgaagaaatactctcaccacagg
aatatagccacgtactatggtgcttttataaagaaaagtcctcctgggcatgatgatcag
ctctggctcgtcatggagttctgtggtgctgggtccattacagacttggtgaaaaataca
aaaggaaattccttgaaggaagattggatcgcatatatctgcagggagatactcagggga
ctggcacatcttcatgtccaccatgtcattcatcgtgatatcaaagggcagaatgttctg
ctgacagaaaatgctgaagtgaagctagtggattttggtgttagtgcgcagctggacaga
accgttggtagaagaaatacgtttattgggacaccttactggatggcaccagaagtcatt
gcttgtgacgagaacccagatgcaacatatgattacagaagtgacctgtggtcattgggg
atcacagcaattgaaatggcagaaggagcacctcctctttgtgacatgcacccgatgaga
gcactgttcctcattcccaggaatccaccacctagactaaaatcaaagaaatggtcaaag
aaattttttagctttatagagagttgtctggtgaagaattacatgcagcgtccctcaacc
gaacatctgttgaaacatccttttatccgagaccagccaaatgagcggcaagttcgaatt
cagcttaaagatcacattgacagaacaaggaagaagagaggagaaaaagatgaaaccgaa
tatgaatacagtgggagtgaagaagaagaggaggagttgcctgagcaagaaggagagcca
agctcaattgttaacgtgcctggagaatcaactcttcgtcgtgatttcctgcgattgcag
caggagaataaggaacgttccgaagctatgcgcaggcagcaactgcttcaggaacagcag
ctccgagaacaagaggagtataaaaggcagttgctagcagagcgtcaaaaacgcatcgag
caacaaaaagagcagagacggcgacttgaagagcaacagagacgtgaacgagaagcacgg
aggcaacaagaacgtgaacaaaggaggcgtgagcaagaggagaaacgaagattggaagaa
cttgaacgtcgaaggaaggaagaggaggaaagaagaagggcagaagaagaaaagaggcga
gtggagagagagcaggagtacatcagacgtcagcttgaagaggagcaacgtcatttggaa
attctccagcagcaattgctccaagagcaggccatgttactggagtacaaatggcgtgag
atggaagaacaacgccaggctgagagattacagcgtcagttgcagcaggagcaagtctat
ctcctgtcccttcaacatgaccagagacaacaggagaggaacaaacaaccttaccatgca
tcagagccaaaatctcactttgagccaactgatagaggcagagaggctgatgaaaggttc
aagaagagtaaccagggctcgcctcaagcacaatcaaaacaaagtagcaaagttttggag
cctccagtgccttcacgatcagagtcgttttcaaatggaagttctgaacccaatccaact
gcattgcataggcccatggagtcacaggttccagtgagaactacacccaggtctcctgtg
ttgtctcgtcgagattctccattacaaggcagcagtcagcctagtgcccagaatgctgca
agaagcaatatagagcccagactgttgtgggagagggtggagaagctcgtaccaagacca
ggcagtggcagttcctcaggctccagcaactctggctcacagccagggtctcatcctggc
tctcagactggatctggggaacgttacaggctgcgatcatcttcaaaatctgagggttca
ccatcacaacgccatgaaaatcttaccaaaaaaacagaagataaaaaggactttaggcct
agcagaccaactggcgaagtggatcttgctgccttggctaaggaactccgggctgtggag
gacatccggcctccccagaaagttactgattattcgtcatcaagtgatgaatcgggaacg
actgatgatgaagatgaagatcttgaccaggaagggacagacgagactggtcctatgtcc
gatgatgctagagcaatatcgtcttcaaagctgagcaatggagagactgaatcagtgaat
acaatgatagttcacgacgatctggagttgccgactgaaacttctgttactccctctaaa
gatggcactttaattgttcgacagagcgcaggtgacttaaagcgtgccagccaccatgag
agtaatggctttgcaagccgcattcacctcttgccagatctcatacagcaaagccattcc
tccacctccccaaccacccaacaggctcccatcctgtcccctcagctaccccgggacgaa
cttactactaatgagacccagtcagcagggagcacactccaaaaacacaaatcctcctcg
tcattcacaccatttatagatcccagattactgcagatctctccatcaagtggatctact
atatcttctgtggttgtgctttccagcgatcagattagaccagactccatgaggcaggat
ccaagtagaaaaggctcagttgtcaatgtaaatccaaccaacacaaggccacagagtgac
acaccggagattcgcaagtacaagaagagattcaactctgagattctttgtgctgcctta
tggggtgtgaacttattggtgggtacggagagtgggttgatgctgttagacaggagtggc
caagggaaggtgtatccattaatcaatcgaaggcgcttccaacagatggatgtgcttgaa
ggcttgaatgtactggtaacaatatcagggaagaagaacaaattgcgagtatattacctg
tcctggttaagaaacaagattttacataatgatcctgaagtggagaaaaaacaaggatgg
acaactgtgggggacttagaaggatgtgtgcactacaaagttgtaaaatacgagaggatc
aagtttttagtgattgctttgaagaattctgtggaagtctatgcatgggcccccaagcca
taccacaaatttatggcctttaagtcatttacagacctgttgcacaagccattgttggtg
gatctcacagtagaggaaggacagaggctaaaggtgatctacggctccagcgctggcttc
cacgcggttgatgtagattcgggaacagtctatgatatttatctacccacacatatccaa
agcagcatccagccacatgctattatcatccttccaagcacagacggaatggagctgttg
gtctgttatgaagatgaaggtgtctatgttaatacttacggccggattactaaagatgta
gttctgcagtggggcgagatgcctacatctgtcgcatatatccgatccaatcagattatg
ggctggggagagaaggcaattgaaatccgttcagtggagaccggacatttggatggtgtt
ttcatgcataaaagagcacaacgactaaagttcctctgtgaaagaaatgacaaggtcttc
tttgcttcagtccgttccggtggaagcagccaggtttactttatgactcttggcaggagt
tcacttctcagctggtag

DBGET integrated database retrieval system