KEGG   Callorhinchus milii (elephant shark): 103172822Help
Entry
103172822         CDS       T03088                                 

Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103172822
Enzymes [BR:cmk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     103172822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 103172822
NCBI-ProteinID: XP_007883720
Position
Un
AA seq 139 aa AA seqDB search
MRYTTTRGALANVSFERVLFSGFAPDGGLYMPENIPRLEPETLREWSGFSYPRLVKEICA
LYISREELSRACIDDLIDAAFSRFPQEEVVSMARLGAGLNVLELWYGITHTFKDLAMSCV
AQLLQHFLSKKNQHVTVLV
NT seq 418 nt NT seq  +upstreamnt  +downstreamnt
atgagatacacaaccactcgtggggctttggccaatgtctccttcgaacgagtccttttc
tctggctttgcaccggacggtggcctttacatgcctgaaaatatcccgaggctggagccg
gagaccctgagggagtggagtggcttctcgtaccctcggctggtgaaggagatctgtgcc
ctgtacatctccagagaggaactgtcgagagcatgtatagatgacctgattgacgctgcc
ttcagccggttcccccaggaggaggtggtgagcatggcgaggctgggggctggcctgaac
gtgctggagctgtggtatggtatcacccacacattcaaggaccttgccatgtcctgtgtg
gctcagctactccagcacttcctcagcaagaagaaccagcatgtcacagtgctcgtgg

DBGET integrated database retrieval system