KEGG   Callorhinchus milii (elephant shark): 103173052Help
Entry
103173052         CDS       T03088                                 

Definition
(RefSeq) heat shock-related 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk03040  Spliceosome
cmk04010  MAPK signaling pathway
cmk04141  Protein processing in endoplasmic reticulum
cmk04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103173052
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103173052
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103173052
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103173052
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmk01009]
    103173052
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmk03041]
    103173052
   03009 Ribosome biogenesis [BR:cmk03009]
    103173052
   03110 Chaperones and folding catalysts [BR:cmk03110]
    103173052
   04131 Membrane trafficking [BR:cmk04131]
    103173052
   03051 Proteasome [BR:cmk03051]
    103173052
   03029 Mitochondrial biogenesis [BR:cmk03029]
    103173052
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103173052
Protein phosphatases and associated proteins [BR:cmk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103173052
Spliceosome [BR:cmk03041]
 Complex B
  Other components
   Prp19 complex
    103173052
 Complex C
   Prp19-CDC5 complex
    103173052
Ribosome biogenesis [BR:cmk03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103173052
Chaperones and folding catalysts [BR:cmk03110]
 Heat shock proteins
  HSP70 / DNAK
   103173052
Membrane trafficking [BR:cmk04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103173052
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103173052
Proteasome [BR:cmk03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103173052
Mitochondrial biogenesis [BR:cmk03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103173052
Exosome [BR:cmk04147]
 Exosomal proteins
  Proteins found in most exosomes
   103173052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 103173052
NCBI-ProteinID: XP_007883910
UniProt: A0A4W3GJL4
Position
Un
AA seq 650 aa AA seqDB search
MAAPKLLAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDPAKNQ
VAMNPGNTIFDAKRLIGRRFDDHVVQSDMKHWPFTVISDGGKPKIEVEYKGELKSFFAEE
ISSMVLTKMKEIAEAYLGTTVNNAVITVPAYFNDSQRQATKDAGAISGLNVLRIINEPTA
AAIAYGLDQSTTGEHNVLIFDLGGGTFDVSILTIEEGVFEVKSTAGDTHLGGEDFDSRLV
SHFIEEFKRKFKKDITQNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSIT
RARFEELNGDLFRSTLEPVEKALRDCRIEKLQIKDIVLVGGSTRIPKIQKMLQDFFGGKE
LNKSINPDEAVAYGAAVQAAILTGDKSENVQDLLLLDVAPLSLGIETAGGVMTALIKRNT
TIPTRQTQVFTTYTENQASVLVQVFEGERSMTKDNNLLGKFDLSDIRPAPRGVPQIEVIF
DIDANGILNVSAVDKSTGRESKITITNDKGRLSKGDIERMVDEAERYKTEDEANRERVTM
KNALESYVYAIKQALDDEKMKGKLSEEEQKAIAAKCQEVLSWLETNQMATKEEFEYQLQE
LEKVCKPIIKFLRCGCSGMSSGINLGAGGIPRAPSSGTEGTSGPTIEEID
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccccaaattgctggccatcggcatcgacctgggcaccacctactcgtgtgtg
ggcgtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacg
cccagctacgtggccttcaccgacaccgagcggctgatcggggaccccgccaagaaccag
gtggccatgaaccccggcaacaccatcttcgacgccaagaggctgatcggcaggaggttc
gacgaccacgtggtgcagagcgacatgaagcactggcccttcacagtgatcagtgacggg
ggaaaacccaaaatcgaggtggagtacaaaggagaactgaagagcttctttgctgaggag
atctcatccatggtgctgactaagatgaaagagattgcagaggcttatttgggcaccact
gtgaataatgctgtcattacggttcctgcttactttaatgatagccagagacaagccacc
aaggatgctggtgccatctctggcttaaatgtactgaggatcatcaatgaaccaactgca
gctgctattgcttacggcctggaccaaagtacaactggtgagcacaatgtgctgatcttt
gacctggggggtgggacttttgatgtttctatcttgaccattgaggaaggggtcttcgag
gtcaaatccacggctggggacactcacctgggaggggaagattttgacagccgcctggtg
agccatttcatcgaggagttcaaacggaaatttaagaaggatatcacacaaaacaagcga
gcggtgcggcgtttgcgcaccgcttgtgagcgtgccaagaggaccctgtcttccagcacg
caggccagcattgagattgactccctgtttgaagggattgatttctacacctccatcacc
agggctcggtttgaggaactgaatggtgacctgttccggagtacactggaacccgttgag
aaagctctgcgggattgcagaattgagaagctgcagattaaggacattgtccttgtggga
ggctccaccaggatccccaaaatccagaaaatgcttcaagacttctttggtgggaaagag
ctgaataaaagcatcaatccagatgaagccgtagcgtatggagcagctgtccaggcagcc
atcctaactggtgataagtctgagaacgtgcaggatttgttgctactggatgtcgctcct
ctgtctcttgggattgaaacggctggtggggtgatgaccgctctgatcaaacgcaacacc
accatccccacaaggcaaacccaagttttcaccacttacactgaaaaccaagctagtgtt
ctcgttcaagtctttgaaggcgaaaggtcgatgaccaaagataacaaccttcttggcaag
tttgacttgtctgatatccgaccagctccccgaggagtgccgcagattgaggtcattttc
gatatcgatgccaacggaatcctgaatgtgtcggcggtggacaagagcacaggccgagag
agcaagatcaccattaccaacgacaagggccgattgagcaagggcgacattgagcgcatg
gtagatgaggcagaacggtacaagactgaggacgaggccaaccgtgagagagtgaccatg
aagaatgccctggaatcctatgtctacgccataaagcaagctttggacgatgagaaaatg
aaggggaagctcagcgaggaagagcagaaggctatcgctgcaaagtgccaggaagtcctg
agttggctggagaccaaccagatggccaccaaagaggagtttgagtaccaactgcaggag
ctggagaaagtctgcaagccaatcatcaagttcctccggtgtgggtgcagtgggatgtcc
tctgggattaatctaggggccggcgggatccccagagcaccgagtagcgggactgagggt
actagtggacccaccattgaagagattgactga

DBGET integrated database retrieval system