KEGG   Callorhinchus milii (elephant shark): 103173752Help
Entry
103173752         CDS       T03088                                 

Gene name
nme6
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 6
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00230  Purine metabolism
cmk00240  Pyrimidine metabolism
cmk00983  Drug metabolism - other enzymes
cmk01100  Metabolic pathways
Module
cmk_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cmk_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
cmk_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103173752 (nme6)
   00240 Pyrimidine metabolism
    103173752 (nme6)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103173752 (nme6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmk04131]
    103173752 (nme6)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     103173752 (nme6)
Membrane trafficking [BR:cmk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    103173752 (nme6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 103173752
NCBI-ProteinID: NP_001279453
UniProt: K4FSG4
Position
Un
AA seq 181 aa AA seqDB search
MEATVRLSRPVLQLTLALVKPDAVAHPLILQAIHQKILENDFIIVTNRDLTWSREASQTF
YSQHSGRFFYQRLVEFMSSGPLRAYILAHEDAIRHWRKIMGPTQVCRARYTAPHTIRGSY
GLTDTRNSTHGSDCPESASRELATFFPEFSEGAWAASGHSRGDFLYHTERQVHLVRSREA
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaggctacagtccggttgtccaggccggtgttacagctgactctagctctggtcaag
cccgacgcggtggctcaccccctgatcctgcaggccattcatcagaaaattctggaaaat
gacttcatcatcgtgacaaaccgggacctgacgtggagccgcgaggcttcccaaaccttt
tactcacagcattcaggcaggtttttctaccagaggctggtcgagttcatgtccagtggt
cctttacgtgcctacatcctggcccacgaggatgcaatcagacactggaggaaaataatg
ggccccactcaggtttgccgcgcacgatacacagctccacacaccatccgggggtcatac
ggcctgacagacaccaggaacagcacacacggctcagactgccctgaatcagcctcgagg
gagttggccaccttcttcccggagttcagtgagggagcctgggcagcgagcgggcacagc
cgtggtgacttcctgtaccacacagagcggcaggtacacttggtcaggtcccgggaggca
gagtga

DBGET integrated database retrieval system