KEGG   Callorhinchus milii (elephant shark): 103174900Help
Entry
103174900         CDS       T03088                                 

Gene name
pik3c2a
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00562  Inositol phosphate metabolism
cmk01100  Metabolic pathways
cmk04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103174900 (pik3c2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    103174900 (pik3c2a)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     103174900 (pik3c2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_C2 PX C2 DUF4135 DUF1722
Motif
Other DBs
NCBI-GeneID: 103174900
NCBI-ProteinID: XP_007885702
Position
Un
AA seq 1702 aa AA seqDB search
MAQISSRSGFKQPAAGMRAVGREEALQMETEALAKLQKERSQGAKDCLTRSLGSGHLKAQ
AGVRQEYDLIHFPEAEGSNQEAERVLSDLDIKNLTEAELEKLLLDSSFGPKSCSRPRTLP
NAPLLSLSFSGQLYGQPAFPACPWAASTVGSRGPVYQAPQPPLSFPKQPDAFRNGFYPGQ
SGFRPLEPLYLSLQGHRFVPFPRQPAVAVQVPALPVYTPVTPELAKLYDQIASTSEYLRN
SKSSGDLESAGTMAPRLATSPGAREASSMFDWLDLDPLSKPRLEAPSPGEGGEREGPGAV
TIAGDPWEQVLQRQDDTQPASATARQRATTQPNGKVTSGASVTRSLSLNLRSTNSQLSHR
ASGHGTKTSQGENRSCSVPTGASCLDQMDSQNHEVAAFCQEITKIRSACPHNNHSTNPGY
ILSPIMLHWDTNGESTSVKVSIEIEGFQQPVTFTCDVSSHVELIIMQALCWVHDDLNQVN
MDSYILKVCGQEEVLQNKHCLGSHEYIQNCRKCDTEIKLQLMSHSTICRALARTADDDEV
PTDLEKFLQKVEKPFKEIISRQSLTELLETYHGHVKTCLQNENKQYKTVDRVIQAVKNIC
SALDGVETKTITDAVKKLKRAVSLPKSKTLEVRSKVGDDSGDGGKNGSVPAVSALEGSLG
ELTVAVNELLQQYLSSFSCSPGSAGALPTSAKPTREARATKEHLQFTLFAAHRIPPAWIS
SFEKYYLMCSLTHNGKDLFKPVQSKKVGTYRGLFCHIKWDELISFPIPIAQLPLESMLSL
GLYGILNPSAAGSPDSNKQRKGPEYLGQVSVPLFSFNRVLTCGTKLLRLWTSILGNPAGG
TINRKGSSMDRIVLQVDFPSFAFDVVYCPPQPSRVVELDFDTLDTETQKQLLDVFAKDSA
FELSKTDKEHLWDKRQYCFSHKNSLPKILASVPSWDWDSLPEIYSLLQQWIPLCPVYALE
LLDSKFADQEVRSVAVNWLEAVTDDKLVDYLPQFVQAVKYECYLSSALVRFLLSRALGSI
LVAHHLYWLLKDSLHNPHFGVRYELILGGLLCVCGRALREEFEKQSWLVQKVGMVAEKVR
LASGSARQVTLQEGMEGVQCSLKHKFRLPLNPSLVAKELNVKACSFFNSNAVPLKVALVN
ADPLGDEINVMFKVGEDLRQDMLALQMIKIMDKIWLQEGLDLRMVIFKCISTGKDQGMVE
LVPASETLRKIQVEYGVTGSFKDKPLAEWLRKYNATEEEYEKASENFIYSCAGCCVATYV
LGICDRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKP
TSRFQLFVDLCCQSYNLIRKHASHFLNLLSLMLSSGLPELTIQDLKYVQDALQTQTTDAE
ATIFFTRLIESSLGSMATKFNFLIHNLAQLRFSGLPSTEQAILSFSPKTYSLKQDSRIKE
VTIFTYQKRYNPDKYYIYVVRVLRDGQMDSTFIFRTFDEFQELHNKLGLLFPLWKLPGFP
NKVVLGRTHIKDVAAKRKVELNNYVQCLMSSSPEVAECDLVYTFFHPLARDEKAEGIDGM
VKLRDVPPSPGAGQVGGEVKLSISYRNNTLFIMVMHIRDLVTEDGADPSPYVKTYLLPDP
HKVTKHKTKVSRKTRNPTYNEMLVYSSYSKETLQQRELQLSVLSAESLRENVYLGCVTLD
LKDFDLSKETVNWYKLTAAPVL
NT seq 5109 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatatccagcagaagtggattcaaacagccggctgctggcatgcgagccgtg
ggcagagaagaggccctgcagatggagacagaagccctggctaagctgcagaaggagagg
agccagggcgccaaagactgcctaacccgctcccttggcagcggccacctgaaggcccag
gcgggggtccggcaagagtacgacctgatccactttccggaggccgagggctcgaaccaa
gaggccgagcgagtgctgtccgacctggacatcaagaatctgactgaagccgagctggag
aagttactgctcgacagtagttttggtcccaagagctgttcccgtccgcgcactctcccc
aacgcccctcttctcagcttgtccttttccggtcagctgtacgggcagccggctttccct
gcgtgtccgtgggccgcgtccacagtgggctctcgggggccagtgtaccaggccccgcag
ccgcccctgagcttcccgaagcagccagacgccttccgcaatggtttctacccgggccag
tcgggcttccggcccttggagcccctttacctcagcctccaggggcaccgcttcgtgccg
ttccctcgccagcctgccgtggccgtgcaggtgccagccctaccagtctatacgcccgtc
acccccgagctggctaagctgtatgaccagatcgccagcacctcggagtatctgcggaac
agcaagtccagcggggacctggagtcagctggcaccatggccccacgtctcgccacctcg
cccggcgccagagaggccagcagcatgtttgactggctggacctcgatccccttagcaag
ccgcgcctggaagcccccagccccggggagggcggcgagcgagaggggccaggggcggtc
accatcgccggtgacccttgggaacaagtcttgcagagacaggatgacacacagcctgcc
tccgccacagcgcgccaaagagcgaccacacagcctaacgggaaggtcacctccggagct
tcggtcactcgcagtttgtcgctcaacctgcgctcgaccaactcccagctctcacaccga
gcctcagggcacggcaccaagacttcccagggtgaaaataggagctgcagtgttcccaca
ggtgctagttgtctggatcaaatggattcacagaatcatgaggtggcagctttttgccaa
gagatcaccaagattcggtctgcgtgtccgcacaacaaccactccacgaatcccggttat
attttgagtcccatcatgcttcattgggacacgaatggagagagcaccagcgttaaggtc
tccatcgaaatcgaaggatttcagcagccggtgacgttcacctgtgacgtgagctcccac
gttgaacttattataatgcaagctctctgctgggttcatgatgacctgaaccaagttaat
atggacagttacatcctgaaagtctgtggacaagaagaagtcttgcaaaataaacactgc
ttggggagccacgaatacattcaaaactgccgcaagtgtgacacagagatcaagctgcag
ctgatgagtcacagtacaatctgcagagccctggctcgtacggccgatgacgatgaagtg
cctacagatctggagaagtttctacaaaaggtggaaaagcccttcaaagaaatcatcagc
aggcagagtctcactgagctcctagaaacctatcacggtcacgttaagacatgcttgcag
aatgagaacaaacagtacaaaactgtggaccgggtcatccaggccgtaaagaacatttgc
agtgcactggatggtgtggagaccaaaaccatcactgacgccgtaaagaaactcaagcgt
gccgtcagcctaccaaagagcaaaacattggaggtcagatcgaaggttggtgatgactca
ggtgatggtggaaagaatggctctgtgcctgcagtgagtgcgttggagggaagcttgggt
gagctaaccgtggctgtgaatgagctactacagcagtacctaagctccttcagctgcagc
ccaggctccgctggggccttgcccacgagcgccaagcccacgagggaggcccgagccacc
aaggaacatctgcagttcaccctgttcgccgcccaccggatccccccggcctggatcagt
agctttgaaaagtactacctgatgtgctcattgacccacaatgggaaggatctcttcaaa
ccagtgcaatccaagaaagttgggacctatcgaggcttgttttgccacatcaagtgggat
gagctgatcagcttcccgattccgattgctcagctgcccttggagtccatgctgagcctc
ggtttgtacggaatattgaatccctcggctgccggatcaccggattctaacaagcaacgg
aaggggccggagtaccttggccaagtttctgtgccacttttcagttttaaccgcgtgttg
acttgtggaacaaagctgctacggctctggacgtccatccttgggaatccagctggtggg
acaataaatagaaaaggcagctcaatggacagaatagtgctgcaagtggactttccatcc
tttgcctttgatgttgtctactgccctccgcagcctagccgggttgttgaactggacttt
gatacgttggacacagagacccagaagcagctccttgatgtatttgccaaagactcggca
tttgaactttctaaaactgacaaagaacatctgtgggacaaacgacagtactgtttttcc
cacaaaaacagccttcccaagattctggccagcgttccgagctgggattgggactctctc
cccgagatctactctctgctccagcaatggattccgctctgccctgtgtacgccttggag
ctgctggattcaaaattcgcggaccaagaagtgcgaagtgtcgctgtgaactggctcgaa
gcagtcaccgatgacaagcttgtggattacctgcctcaatttgtacaggctgtgaagtac
gagtgttacctgagcagcgccttggtgaggttcctcttgtctcgggctctgggaagcatt
cttgtagcacatcacttgtactggctgctgaaggattccctccacaaccctcacttcgga
gtgcgttacgagctgattctgggcggcctgctgtgcgtgtgcgggagggcattgcgggag
gagtttgagaagcagagctggctggtgcagaaggtgggaatggtggcggagaaggtgcgg
ctggcgagtggatcggccagacaggtcacccttcaggagggtatggagggtgtccagtgc
tccctcaagcacaagtttcggctgccactgaacccgagcttggttgcgaaggagctcaac
gttaaggcctgctctttcttcaattccaatgcagtgccactgaaggtagcattggttaac
gcagacccactgggggatgagatcaatgtaatgtttaaggtcggggaggatttgcgacaa
gacatgttagcgctgcaaatgatcaagatcatggacaagatctggcttcaggaagggcta
gacctgcgcatggtcattttcaaatgcatctcaacggggaaggaccaaggtatggtggag
ctggtgcccgcttcagaaaccctgcggaagatccaagtggagtatggagtgaccggctcc
ttcaaggacaagccgctggccgaatggctgaggaagtacaatgctacagaggaggagtat
gaaaaggcatctgagaacttcatctactcgtgtgcgggctgctgtgtagccacctacgtg
ctgggcatctgcgaccgtcacaatgacaacatcatgttgcgatccaccggccacatgttc
cacatcgacttcgggaaattcctgggtcacgctcagatgtttgggagcttcaaaagggat
cgggctccgtttgtcctgacgtcagacatggcttacgtgattaacggtggcgagaagccc
accagtcgtttccagctgttcgtggatctctgctgccagtcgtacaacctgatccggaaa
cacgccagccacttcctgaatctcctgtcgctgatgctgtcctctgggttaccggagctc
accattcaggatctgaagtacgttcaggatgctctccaaacacaaacaacagacgcagaa
gccaccatctttttcaccaggttgattgagtccagcttgggcagcatggccaccaagttc
aacttcctcattcacaacttggctcagctgcgcttttcggggctgccgtccacagagcag
gctatcctctccttctcgcccaagacctattccctgaagcaagacagccgcatcaaagag
gtgaccatcttcacgtaccagaagaggtacaaccccgacaaatactacatctacgtggtg
cgagttttacgtgacgggcagatggattccacgtttatcttcaggacctttgatgagttt
caggagctgcacaacaagctgggcctcctcttccccctgtggaagctgccaggcttcccc
aacaaagtggtgctgggacgcactcacattaaagacgtggcagccaaacggaaggtggag
ctcaacaactacgtgcagtgtctgatgagcagctcccccgaggtggctgagtgtgacctt
gtctacacctttttccatcctctggcgcgggatgagaaggcagaaggaattgatggaatg
gtgaaactcagagacgttcccccgagccctggggcgggtcaggtgggaggggaagtcaag
ctctccatttcgtatcgaaacaatacactcttcatcatggtgatgcacatccgagatctg
gtgacggaggatggagcagatccaagcccatatgtaaagacctatttactccctgatcca
cacaaagtaaccaagcacaagaccaaggtctcacggaaaaccagaaacccaacttacaat
gaaatgctggtgtacagcagttacagtaaagaaactcttcagcagagggagttacagctc
agcgttctgagtgcggaatccttgcgagaaaacgtttacctcggctgcgttacattggac
ctgaaagattttgacttgagcaaggagaccgtcaactggtacaaactgactgctgcccct
gtactgtag

DBGET integrated database retrieval system