KEGG   Callorhinchus milii (elephant shark): 103174913Help
Entry
103174913         CDS       T03088                                 

Gene name
st6gal1
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 1
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00510  N-Glycan biosynthesis
cmk00514  Other types of O-glycan biosynthesis
cmk01100  Metabolic pathways
Module
cmk_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103174913 (st6gal1)
   00514 Other types of O-glycan biosynthesis
    103174913 (st6gal1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cmk01003]
    103174913 (st6gal1)
Enzymes [BR:cmk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     103174913 (st6gal1)
Glycosyltransferases [BR:cmk01003]
 Terminal extension
  Sialyltransferase
   103174913 (st6gal1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 BRK
Motif
Other DBs
NCBI-GeneID: 103174913
NCBI-ProteinID: XP_007885730
UniProt: A0A4W3K3K3
Position
Un
AA seq 466 aa AA seqDB search
MKTKHLFCFFGFFAMFCMLWFQPLKEKKLVKNSYAEVRKIPDSVSQHDIQTALRRNVKKV
DGSTFEYTEVQPFWEGDNEIYAGEHSREVVLREINGTKLSTGPDIQDQSLIKEALPNGRQ
EAEKKSPNDPKLAVKPAKVLQADQNTNTRSIWNEDSSSMNLVPRLRTVKNNYVAMNKYIV
NFTGRKHSRKLSREELICELKQRVPVKTIQFGEDPFTTSDWQKSLPSKSLMEELGQFRTC
AVVSSAASILHSKLGNEINGHDAVLRFNAAPTSGFEFDVGTKTTIRIINSQVISTGDYQF
HAKSLYRTGVLLTWDPAPYAANLSEWFKNPDYNFFEDYKKYRENNPEQPFHILHPSIQWK
LWNIVQENTAENIQPNPPSSGLMGIVLMMTLCDQTDVYEFLPSQRQTDRCHYYEMFHDQA
CTMGAYHPLMFEKNLVKRMNHGTDEEIHMYGKVTLPGFRTVLCPST
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaaacatttattctgcttttttggtttctttgctatgttttgcatgctatgg
tttcagcccctgaaagagaagaaactggtcaaaaacagttatgcagaagtaagaaaaatc
cctgatagtgtcagtcaacatgatatacaaactgcactgagaagaaatgtgaagaaggtt
gatgggtcaacctttgaatatactgaggtgcaacctttttgggagggtgataatgaaatt
tatgcaggtgaacacagtcgtgaagttgttttgagagaaattaatggaacaaaattatca
actggaccagatattcaggatcaaagtctaatcaaggaagctttgcccaatggaaggcaa
gaagctgaaaagaaatctccaaatgatcccaaactagcagtgaaacctgccaaagttctg
caggcagatcaaaacacgaacacacgttcaatttggaatgaagacagctcttcgatgaat
cttgttccgcgcctgcgtacggtaaagaacaattacgtggctatgaacaaatacattgtt
aatttcaccgggagaaaacactccagaaagctcagccgtgaagaactcatttgtgaactg
aaacaaagagtcccagtgaagacaattcagttcggcgaagatcctttcacaacatctgac
tggcagaaatctctgccaagcaagtccttaatggaagaacttgggcaattccgtacgtgt
gctgtggtgtcatcagctgcctctatcctccattccaaactgggaaatgaaataaatggt
cacgatgctgttctgagattcaatgcagcacctaccagcggatttgagtttgatgtggga
acaaagactacaattcgaataattaattcacaggtcatctcaacaggtgattaccagttt
catgctaaaagtttatacagaaccggagtcttattaacctgggacccagcaccatatgca
gctaatctttccgagtggttcaagaacccagactataatttctttgaggactacaaaaag
taccgtgaaaataatccagaacaaccgttccatattctccacccaagcatacagtggaag
ctgtggaacattgtgcaggagaacactgctgagaacatccaaccgaatcctccctcctct
gggttgatgggtattgtgttaatgatgaccctctgtgatcaaactgatgtgtatgaattc
ctgccctcacaacgacagactgaccgctgccattattatgaaatgtttcacgatcaggcc
tgtacaatgggtgcttaccacccattaatgttcgagaaaaatctggtgaaacgcatgaac
catggcacagatgaggaaatccacatgtacggcaaagtgactttgcctggttttcgaaca
gtgctgtgtcctagcacatga

DBGET integrated database retrieval system