KEGG   Callorhinchus milii (elephant shark): 103175265Help
Entry
103175265         CDS       T03088                                 

Gene name
abhd12b
Definition
(RefSeq) abhydrolase domain containing 12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103175265 (abhd12b)
Peptidases [BR:cmk01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   103175265 (abhd12b)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   103175265 (abhd12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LIP Abhydrolase_3 Peptidase_S9 Thioesterase Abhydrolase_2 Abhydrolase_4 TRP_2 DLH PAF-AH_p_II
Motif
Other DBs
NCBI-GeneID: 103175265
NCBI-ProteinID: XP_007886387
Position
Un
AA seq 331 aa AA seqDB search
MGPGRPGPRRWIHRSLIFLIKACVLTVLIIYVTIPFAMKINPVIAPMMIYFNLFRSPFID
LQHPGKFINHTVNLYLTPEEGVTVGVWHTVPESRWMETRGKDQQWYEATLSDGNPVIVYL
HGNGGNRAESYRVALVKVLSANGFHVLAMDYRGWGDSTGYPSEEGLTMDSVHLYEWARAR
SGRSFVCLWGHSLGTGVASNTARRLQEKGRPADAIVLEAPFTTIREEVTCHPFSVIYKQF
PGFEWFFLDPVTENNIVFHNIENLKSVSSPVLILHAEDDPIIPFELGRKLYRSLHDSRIF
KEQVKFVAFPGILGYKHNLIYRDPRLPEILK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgggcccggggagacccggtccccggcgctggattcacagaagcctcatatttctcatc
aaggcgtgtgttttaacagttttaattatttatgtcaccataccatttgccatgaagata
aatcctgttattgcaccaatgatgatctattttaatttattcagatctcctttcattgat
ctgcagcatcctggaaagtttataaaccacactgtaaatctatatctcactcccgaagaa
ggagttacagttggagtctggcatactgtaccagaaagtaggtggatggaaactcgaggg
aaagatcagcagtggtatgaagctacactgtcagatggtaatccagtaatagtttatctc
catggcaatggaggcaatagggctgaaagctacagagttgcactggtaaaggtgctgagt
gcaaatggatttcatgtactagccatggactatagaggatggggagattctacaggttac
cctagtgaggaaggattgactatggattccgtccacctctatgagtgggccagagctcgg
agtgggagaagttttgtgtgtctctggggacactcgttgggcactggtgtggcctcaaac
actgcacgaaggctacaagagaaaggacgtccggctgatgcaattgtactggaagctcca
tttacaactatacgagaagaagtaacctgtcacccattttcagtgatttacaagcagttt
cctggatttgaatggttcttcttagatccagtaacagaaaataatattgtttttcataac
attgaaaatctgaagtcagtatctagccctgtgttgattctgcatgcagaagatgatccc
atcataccgtttgaattgggtagaaagctctacagatcgctgcatgattcacggatattc
aaggaacaagtgaagtttgttgcattccctggcatacttgggtataagcacaacttaatt
tatagagacccacgattgccagaaattctaaagtaa

DBGET integrated database retrieval system