KEGG   Callorhinchus milii (elephant shark): 103176238
Entry
103176238         CDS       T03088                                 

Gene name
ahrr
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cmk03000]
    103176238 (ahrr)
Transcription factors [BR:cmk03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    103176238 (ahrr)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 103176238
NCBI-ProteinID: XP_007887853
UniProt: A0A4W3JZ31
Position
Un
AA seq 807 aa
MIPLGECMYAGRKRRKPVQKHKTTPASIKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAFGEKESRKESHQLTKNDMGVNEPTLMAENRTSAGQLLL
EALNGFVLVVSADGMIFYVSPTIIDYLGFHQTDVMHQSVFDFIHIDDRQEFQRQLHWAMN
PPHQLSGQEHLTQTVNNDDYLSCMKVQDPSSLPPEFSPFLNRCFISRVRCLLDSTSGFLT
MQFQGKLKYVHGQNRRTLSGTALPPQLGLFCIAVPVLLPSITEMKLKSVLLRANKLDLSS
MTLDAKDKAAAGLSEDELRTRSGCHYLHFADMLYCAENHIRMVKSGENGLTVFRVLTKDG
QWVWLQANGRLLCRNEWPDYTPVLPEDLKQIEETEERENTRKVFREDRLTGTGVGLPYSD
CSETSLPLKHLFSQQLAKATNEGREAKCTPIQGESAAGQEEPLNFCTSFSRAHKASITHN
LWVSEHSRDSSNSQPLRAMQRLSNVPIRMPRTLGNRGRPLCEPQHRGNSQASNIPNQPQG
FGSIGEEVESYGALHHIDLESYPGQSCKSEGTLVPSEHSHQRGRETPTTYCNPQMFPGVH
IKSEYDAEPENRPDLTIGTPDRLWADGREMGKNTMASYTYQPPFKVNPNVLEQVPPSKKL
KGVFHQQYCRVGPAKDPNTWTTSSICSLNSPLKPNKDLTHLGSQTHFGSQTAAHSHCIHS
NQHVDCQEGQTYLHHTLEDKGLSQESCRLPRQFNRHDLVHTVIKREPAASPPWCPEDPHN
IQTAFQRNMPNCLLNSLTHKITQNAYL
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgatcccactcggcgaatgcatgtacgcggggaggaaacgaaggaaacccgtccagaaa
cataagacaacaccagcaagcataaagtccaatccatccaaaagacatcgagatcgcctg
aatgctgagttagatcatctggccagcctcctgccattcccaccagatattatttccaaa
ttggacaaactatctgttctacgtctcagcgtcagctacctccgagtgaaaagtttcttc
caagcctttggggagaaggagtcacggaaggaaagccaccaactcaccaaaaatgatatg
ggagtcaatgagcccacccttatggctgagaaccgaacctcagcaggccagcttttactt
gaggcactgaacgggtttgtgctggtggtgagtgcggacgggatgatattttatgtgtct
cccacaatcattgactatctgggatttcatcagactgatgtgatgcaccagagcgtgttt
gacttcatccacatagatgaccgtcaggagttccagagacagcttcactgggccatgaat
ccaccacaccagctctctgggcaggagcacctgacccagacggttaacaatgatgactat
ctgagctgtatgaaggttcaggaccccagctctctgccgccagaattttctcctttcttg
aaccgctgctttatcagccgagtgcgttgcctgctagacagcacatcaggattcctgacg
atgcagttccaaggcaaactgaagtacgtccacgggcagaacaggaggactctgtcgggc
actgctctgcccccccagttagggctcttctgcatcgcagttcctgtgctgctcccttcc
atcaccgaaatgaaactgaagagtgtacttctcagggccaacaaactggatctcagctcc
atgacactcgatgcaaaggacaaagcagctgctgggttgtctgaagatgagctgaggaca
aggtctggctgccactacctccactttgcagacatgctgtattgtgctgagaaccacatc
agaatggtgaagagtggagagaatgggcttacagtcttccgagtgctcacaaaggacggc
cagtgggtttggcttcaagcgaatggccgtctgctctgtagaaacgagtggccggactac
acccctgtgctaccagaagacctcaaacagatagaggaaactgaagaaagagagaatacg
agaaaagtgttcagggaagatcgattaaccggcaccggtgttggtctgccatacagtgac
tgcagtgaaacatccctaccactaaaacatctgttcagtcagcagctggcaaaagccacg
aacgaagggagggaagcaaagtgcacacctattcaaggtgaaagtgctgccggtcaagag
gagccgctcaatttctgcacctcattttccagggctcacaaagcttctatcacgcacaac
ttgtgggtatcggaacactccagggactcgtcaaactcacagcccttgagagccatgcag
aggctcagtaacgttcccatcaggatgccaaggactttgggtaacaggggaaggccgctc
tgtgagcctcagcacagggggaacagccaggcctccaatatccccaaccagcctcagggc
tttggcagcattggggaggaggtggagtcttatggtgccctgcaccatattgatttggag
agctaccccgggcagagctgcaagtcggagggcacactggtgccctctgagcacagccat
caaagaggcagagagacgcccacaacctattgcaatccccagatgttccccggggtgcac
atcaaaagcgagtatgatgctgagccagagaacaggccagacctaaccatcggaacgccg
gaccgtttgtgggctgacggtagagaaatggggaagaacacaatggcgagctacacctat
cagccacctttcaaggttaatcccaacgttttggaacaggtgccaccctctaagaaactg
aagggcgtcttccaccaacagtactgtagggtgggcccggcaaaggatcccaacacctgg
accacaagcagcatttgtagcctcaatagccctttgaaacccaataaagacttgacacac
cttggttcccagacacactttggttcccagacagctgctcattcacattgcattcacagc
aaccagcacgttgactgtcaagaagggcagacttatctccaccacactttggaagacaaa
ggtctgagccaggagtcatgtaggctaccaaggcagttcaacagacatgatctagtccac
acagtcatcaaacgggagcccgcagcctctcccccttggtgccctgaggatccccacaac
atacagacggcattccagagaaatatgcccaactgtttgctgaattcattgactcacaaa
atcacccagaatgcttatttgtaa

DBGET integrated database retrieval system