KEGG   Callorhinchus milii (elephant shark): 103176499Help
Entry
103176499         CDS       T03088                                 

Gene name
ttn
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmk01001]
    103176499 (ttn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmk04131]
    103176499 (ttn)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cmk04812]
    103176499 (ttn)
   04147 Exosome [BR:cmk04147]
    103176499 (ttn)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103176499 (ttn)
Protein kinases [BR:cmk01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   103176499 (ttn)
Membrane trafficking [BR:cmk04131]
 Others
  Actin-binding proteins
   Others
    103176499 (ttn)
Cytoskeleton proteins [BR:cmk04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     103176499 (ttn)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103176499 (ttn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set fn3_2 Pkinase Tissue_fac Ig_6 Pkinase_Tyr C1-set Izumo-Ig Ig_C17orf99 THB DUF5640
Motif
Other DBs
NCBI-GeneID: 103176499
NCBI-ProteinID: XP_007888276
Position
Un
AA seq 27383 aa AA seqDB search
MALSGNSTTFEGCVRGASPLFVTWMKDKDELREDDNIKISFENNIAILHIAAVEHSHSGK
YTCQANNDAGIEKCFATLLVAEPAQILEKTEPLNVTSGTTAILECVVAGTPELKVKWFKN
GHEVTSSRKYKISCVNKVASLKVLSVDKDDSGEYTFEVKNEFGQDSYKTSLTVLDRMIAP
SCTRKLKKMDNILGAFMHMECKVSGSHPINITWCKDDKEIMANDKYKISFEDNTAVLEID
QLEITDGGNYYCKATNDAGSCDCSGFLSVKEPPSFVEKIVSQGSIIGSTVQFKSVVAGTL
PLTVKWFKGSRELKPGTACSIWNEGSTHFMELISTKTTDAGGYTCKVSNDVGAETCNAEL
LIKEPPTFTQKPAPTAVLKRGEFGRFECKIAGTPQITVTWYLNNHEIRASEKYRISFVNS
LALLEIAGISIEDSGDYSCEAQNEAGSNGCNFVVQVKEPPVFTKKLESVEVVKTSDVPLE
CEVTGTGPFDVAWYKDSKHIRPGKKYQMTSDDSLASLCILKSDFSDAGEYQCTVKNDVGS
CSCSAGVSLKEPPGFTQKFENMTVFAGKSTVFQCLVKGSKPLYVTWMKDKDDVKEDGDIA
MSFENNIATLQITGTGEKHAGKYICQAKNDAGTEKCSATLLVAEPAKITEQAHSLSVTVG
DPANLECTVTGTPEIKVKCIKDGKELVSGRKYTISFQNNVASLKFPSVCQEDSGDYTFEV
KNKFASCSCKASLTVLDQIVPPEFTRKLRKMDSVLGSFILMECKVSGSLPISFSWYKDDT
IISASKRCKLSSHHNTAVLEINELEMADGGVYACKATNSAGSDDCSNTFIVKEPPSFIER
PVAQEVIPGSSVQFKSVARGTSPLSIKWLKDGRELMSGAECFILIEGSSSLLELFSAKIS
DTGEYTCEASNSVGSETCTTRLFVKEPPYFIKKLDLTAVLKTGETARFECKLTGTPEISV
TWYRNNCAISGSGKHRISFVDSVAIFEITDVSLDDGGKYSCGAQNEAGSESCSIEVKVQE
PPSFSQKLEPTKVLKKGESAHFECRVTGTPEIKVSWFKNDSEIRASNKYKMSFDKSAAVL
EIAESDVPDSGDYICEAHNEAGSVSCSVAVTVKEPPAFSKTLESVHVLKGSDIILQSELT
GTAPFEITWHKDKRQIRASKKYKMTYENYVACLHILKVETSDVGEYQCMSKNDVGSDSCT
GTLKLREPPSFVKKLSNASPVLGESVTLQAIIKGSEPIHVTWLKEKEEVRDHEHVTTSFE
QNVVTLHIAKAESVHAANYTCQIKNDAGMQESTAKVSVLEPATIVEKAESVSVTAGDTTA
LECVVAGTPELKVKWFKDGKELVTGRKYKISFLNKIASLKLLSGEREDSGQYTFEVQNNV
GRDSCKATINVLDRIIPPSFTRKLKKADGILASPILMECKLSGSAPFTIAWLKDGQEIVH
EERYDVSFADNTCNLRISTLETLDAGNYTCKATNAAGNDECSAVLTVKEPPSFMSKPESQ
EVLPDSTARFTSVVTGTAPLKVKWFKGSTELVTGRKCHISLTDSVAVLELLNVNPSESGD
YICQVSNDAGKDSCTANLFVKEPAVFQKKLKDSSIELNKSVCLDCTYSGSPEIKVIWKKN
GFELFQSEKYTLTTTDKSCILEIQHSVREDGGKYTCEVENAAGGDICHAEVTVLEPPTFV
HELVPLEVTLGDAISLSCVLTGTPEIKVSWYKGDTKLRMMSNIGMAFHNNIATLELKKTA
ISDSGEYVCKAENLIGSCSSKATLTVQELKTAPSFTRKLKDMEETMGRPVTFECRLSGSA
PIETAWFKDGVNLSSGGNVTISFIENLATLQILNAEMVDAGEYTCKASNMVGEASCGSKL
TMKEARAAPEFDKTLEAVEVTAGDPVELECHVTGSTPIKVTWLKDNREIRSGGIYKMTFE
NNTPHLTILKAEKGEACQYTCQASNDVGKVSCSAGVTAKERKIPPSFTKKPLETIQDTEG
KAVKLEARISGSQPLSVTWFKDEQEIHQTEHEISFKNNVVLLNMKKALPIDSAVYTCKAS
NEVGFASFTVSVLIKELKTPPVFDIPLKPLTATEGESPQLSCHVHGGEPIKIQWLKDRRE
IKTSDKLKMTFTDGTAALEIKTVVKTDSGDYLCKATNEVGSDSCKAKLTIQGKTTPAKKV
ATPPEPGKIFFIEKPKNTKVTEKSTAAFIAKVGGDPIPNVKWMKGKWRQLNHGGRFFVQQ
KGQDAKLEIKDVVKSDSGEYRCVASNNFGELECSASMEVAEKKEVFIEGDLRAKLKKTPS
KQKEEEPDKEIDIVELLRNVDPKEYEKYARMHGITDFRGLLQAMEQLKMSKEDESHRVEI
EEHERPAQEEFDELIHYIQQKIQNVEPVELIKDIEDQTVRTKVDALFECIIKINYPEIKL
SWYKGTEKLESNDKYEITIDGDIHRLKVKSCEFHDQSNIRLVCGPHISSAKLTVVEPIVE
QHLEHLSGKEGQICIMVCQFSLPNLKTEWFKNGRQIEGRGRYSIHVSDKTQKLTISDVKP
EDQGRFTCKFENLETSADLRVEAEPIEFTKAIQDIVVNEHESATFECEVSFDDAIVTWYK
DTMELQESPKYSFRRTGRRHFMTIHNVAAEDEGVYSVIAQLEPRGEAKSTAELYVSSKDV
VLQPMEPDVPDIGISVETVQVEQKHIKEEVTTYHEEIYEETHEEIFYETIHEEEITEIKA
PKKPVSKTTPEAIVEEEISATRVSKVTRRTGRLPEQIPAPRIPITEEITAQRVSELYEKQ
SIEERVSISTEEEIVAIKVPEVPKKPVPEEVKPVPSKKEVAPAKVPEPSKKPEPSKKPEP
EIIPKKKEVPPKVPEVPKKPVVEEPKPVKVTRKEVVAPVEVPEVPKKPVVEEVKPVTVER
KETPAAKVPEVPKKPVPEEVKPALVPKKQVIPPAKVPEVPKKPVAEEVKPVGVPRREEVT
PVKVPEVPKRPVAEEVKPTAVPTKEEIVPTKVPEVPKKPVPEKVKPVAVQRKEEIAPATV
PEVRKKPVAEEVKPVTVSRKEEPAPAIVPEVPKKHVAEEEPVIVPRRKLISPTEVPEVPK
KPVAEEVKPVTVPGRKVSPPAEVPEVPKRRVTEEVKPVIVPRRKEIPPTEVPEVPMKPVA
EEAKIATILRRKESPPTEVLEVLKKRVVEEVKPVTVPRRKVSPPFEVSEVPMKPVAEEVK
LTTVLRRKESPPTEVPEVPKKRVVEEVKAVTVPRRKVSPPIEVPEVPMKPVAEEVKLATV
LRRKESPPIEVPEVPKKRVVEEVKTVTVPRRKESPPTEVPEVPKKRVVEEVKAVTVPRKK
VSPPFEVPEAPKKPVAEEVKPATILRRKESPPTEVPEVPKKRVVEEVKTVTVPRRKVSPP
IEVPEVPMKPVAEEVKLATVLRRKESPPIEVPEVPKKRVVEEVKTVTVPRRKVSPPTEVP
EVPKKPVAEEVKLATDLRRKESPPTEVLEVLKKRVIEEVKAVTVPRRKVSPPTEVPEVHK
KPVAEEVKPVTVPRRKEAPPTEVPEVPKKPVAVEVKPAAVPERKKSPTEVPKKPVAEEVK
PISVPRRKETPPAEVFEVPEPPEKPVADEVKPVAVPRRKEIPPTQVPEVPKKPVAEEVKP
VTVPRRKEIPPAEVREVPKKPVAEEVKPVTVPRKKEIPPIEVPEVPKKPVAEEVKPVAVP
RRKEIPPTEVSEVPKKPVAEEVKPVTVPRRKVSPPTEVPEVPKKPVAEEVKPVTVARKKE
ILPTEVAKVPVKAAEEEPKPVPASRKEEVAPAKVPQIRKKPIVEERKSITVQREEEVVIV
AAAPKKPIVEEPKPVYVQRREEVTEVQVMEFHEETFEEEYQEIIVQSREEVPSVKVPVVS
KKIVAEEEKLVTLTRKGTAVKVPEAPKKPVPDKAKPVTVAKKEAEPAKVPEAPKKPVPDK
AKPVTVAKKEAEPAKVPEVPKKPALEEEKPVIVPRKLEIAPTKVPEVPKKPVPEEVKPEA
VPTKDKVAPAKVPAVPKKEVAEKVKPAVVPKKEIIIPKKDAAKVPEVPKKPDAVQLKPVP
RKEEAPKVPKVDKKVQPAPISVSRKEAIISKKVPEDVKKPTSEKVTPITVTPRKQVVPLK
DPEVTKQPAYEEDRETYEVIEAYEEYKEEYEVIETYEEHKEEYEVIEPYDEETEELDEEI
EAFEEYTEAYVEEPEEDEEDTEVYEEKEMTIRPKVPEVTEKPVPQKVPIKVPGAPEIGKK
PTPTIASEEEPTKEVPGVTAPITTPIGGKRPVKATEKTEAPLKLKPAVKVPKEVVEDLLE
ITNLKKTSKISKEEEGEQRVIRRKFDASPKEEEKQLELKHRIRVKSPKEVEPDREVLSLK
KDGIFSKEEEENRQSGLKVVSDVPKIDDKVKGTTLKKPDKITMEEDIVDKPLLKKSGRVP
EEEEKEPESVTLKKPSRVPKQEREPEKGLVRKPKEETVKEKELAAKVPGRVPKGIEDRGK
QIILERDDEVPLEKGEKTITPLTKPERVPVEVGEKEKPSVKQVEIPLPEKAKQTVVPMKK
PSKSPKEQEKEEKHLVQKKVHIIPKAEEEKKEHPSLKKVDFPKVVQDEPRIKPSIEEEKP
KGIDIHPMDRMPRETILEKTAEKPIPGQVPPEEADVPPKRVPEKKVVAPKETPPESRFKI
GKGKVPISEEDKEIVELKPIPSKRRASEEKEPQKPPKVPEKQIIMPKEIITSKEKPIASR
SPIGKGKVPVSQEQKEPVQLEKVPSEETPFEEKEPQKIADKVAVFDEKPGEKQLLIGKGK
VPVSEIGKVAVELKKVPSNEVALDEKEPRKVPGRKVISPKVSPKEKTDSVDSTISKGKVP
ISEISEIPKETVEVKKVPSKEVVADEKEPKKIPGRKAIFPKEKPDDVDIRISKGKVPLSE
TPKETVEIKKVPSKEIVADEKEQMKIPGRKVISPKVFPKEKPDAVDSAISKGKVPISETP
KGTVEMKKVPSKEVVADEKEPKKISGKKVISPKQKPEAVDRKIRKEKVPISVKESETVEL
DKVPSEDISQGESEATHEAADEEAYEGEIEEPEEGTEEISSEELPYTEDWEWEGTEGEEE
YGSSVDWECEDDEELVEGVVQTPGKSSKQRDAKAPGEEAGRGRGSPRARKTPSPGDADKK
GLKPGGGRPPGEEAPFAGFQLKAVPLKFVKELKDIVLEEAESIGSSAVFECQISPSTAQT
SWMKDGSTVRESPKHKFTSDGKDRKLHIIDVQLSDTGEYTCVGRLGKQEKMSTAKLIVQE
LPVQFFKTLEEEIMVFKGQPLYLTCELNKDRDVIWKKDGEVVENIPGKLTISVIGLQRSI
TISDSDFSDAGVYTVETANIKCEGKVSVQEIVRKWFVKPLRDQRVKQKETAVFQCEIAKD
TPNIKWFKGEEEISAMPPSKFEIKKVGKILTLTLKNVSPEDQGEYTVEVEGQASTANLIV
DEREIDILLELQSVEVYEKETAVFETEISQDVSVEWKLKGEILRPSPTCEMKDEGTKRTL
TLHNVRLDQAGEVIFRARNATSIAYLRVKEIELDFEVPLSDVTVPEKRQARFECVLTRVV
TKIMWTKGSDILKVGDKYDLVADGKKQILVINNSTFDDEGEYSAEVDAKKTTAKLIVTGT
RLKFLTPLKDQTVKEGNTAHFEIELSHENLPVTWYRNETVLHPSRTVLISTDEKKHVLEI
REVTLDDTCEIKAEVTELSTKGCLIVIEADPYFTVKLQDYTAVERDEVKLECELSKDVPV
KWRKDGEEIRASKIVSMKAEGLRRILIIKKVDNKAKGEYECDCGTDVTKASMNIEARIIK
IMRPLFGVEIFEDETARFEVDISETDVHPQWKLNGETLLPSPNCEILEDGKKHTLILYNC
KLKDSGEVAFQAANAKCAANLKVKEIPITFITPLDDVKVYEKDEAKFECEVSRKPKTFRW
LKGTEEVKSDAKFEVLEEGTKYALVIKEAAFDDEAKYTFEAEDKKTSGKLIIQGIRLEFS
KPIEDQTVKERETAEFVAELSHENIQVVWYKNDVRLHPSRVVTMKDDGKIHAIMFKDVTI
DDTSLIKAEAMDQSSEAKLIVLEGDPYFISKLQDYTAVEKDEVVFQCEISKAGAPVKWLK
DGKELTPSKNIQFKTDGKKRFLIIKRALKTDQGEYSCDCGSDKTTAKLNTEERDIKIMRP
LYSVEITETETARFEVEISEEDVHGNWKLKGESLRPSPDCEIKEEGTKHILILYNVPLGQ
AGQVDFQAANAKSNAHLRVKARVIGLLRPLKDVTVVAGHSATFECELSYEGIPVEWFLKD
TKLEASDRVVTRAEGRVHTFTLRDVQLDEAGKVKITAKDFTTSAKLIVKEPAAEFTKPLE
DQTVEEEATAVLECEVSRENAEVKWFKAGQEIFKSKQYDIVAEGRIRRLIIHGCKPDNSK
TYTCDAKDFKTSCFLSVEAPHIEFTKPLTDLEVKEKDVAKFACEVSREDAKVRWFKDGME
IRKGKKYDITAKGVERLLTIHKCSFDDEAEYECDARTSKTSGMLTVLEEEAGFTKKLADV
EASETDTVRLVCEVSKPDAEVTWYKGDVELPDIGRYEQLTDGKKRILVIHNVNPEDVGEY
NCRLPKGIRTSAKMAVNELAAEFTSRPKNQEVLEGDKAEFVCAVSKESYEVRWFRNDTEL
GTGDKYDIISEGNKRVLVIKDSILDDEGTYAAMVASSRATADLTVIEKLRIITPIKDQLA
KEGQETVFNCEVNVEGARAKWLKNDEVIFDSAKYFLLQKDLVYTLRVKDSQMKDQGTYTI
ALTNNRGEHAACSAELEVKEEELKIIEPLDDCETMEKKSAIFSCKVNRENVTLAWMKGGQ
EITFDRRVSYKIDKKKHSILIKECSFGDEGEYTVTAGQDKSVGELIITEAPTDFTEHLQD
QTVIEFEDAVFSCQLSKEKPAVKWYRNGRELRENKKYQFEKDGSLHTLTVRECRPDDECE
YSCGVEDRRSRARLFVEEIPVEIIRPPQNIFEAPDSDVIFEAELNKDRVEVKWLRNNMII
VQGDKHQMMSEGKVHRLQICNIKPRDQGEYRFIAKDKDARAKLELAAVPTIKITDLNLVI
DAGKPFTMTLPYDAYPRGEAKWFKEDSTTSEYVSLPKQNIDTTVDMTSYRLSDPKRTDKG
RYKVIIANKHGKGEAYINLNVIDVPGPIQNLNIVETYDGEVSLAWDEPDSDGGSKILGYV
VERRDVKRKTWTLATDRADSTEFTVTGLQKVLEYLFRVSARNRVGTGEPVETDVPVLAKN
KFDVPDAPINVDVKDVNKFGATITWEPPEYDGGAEITNYIIELRDRTSVKWDVAMVTSAD
ELSAQLNDVVENREYIFRIRAENKAGIGKPSAATHPVKIMDPIFKPSPPINLKCSDQTKD
SVQLNWEAPLKDGGSPILGYIIERQEEDTDKWIRCTLRLVPETTFKVPGLKQGVKYYYRV
SAENAAGVSDPADALGPLTADDPHVAPSIDLRDFKDGLEVIVPEPLKIRVPISGYPTPTA
TWAVDDKPLESGDRVKMETTARYTQLIVCPSELPDKGVYSLTLENPVLSISGDIKVNVIA
RPSAPMDIKVVEIGRSSVHLTWEPPEHDGDSPLTGYLIEKREVNRKTWVKVIEGVVDLEY
TVPDLYQGRDYLFKISACNKCGPGEPGYIDEPVNVSAPATVPDPPENLKWRDPSASGIFL
TWEPPKYDGGSRIKGYMVEKCQRGSEKWEMCGEPVFDLRFEVTGLTEGQWYSYRVKALNR
QGASRPGKPTDDIHAVDPKEPPEIQLDVKLLAGITVKAGTKVELPACVIGKPEPRVTWTK
AERLLRVDTRITIETKPGHSTVTIMDTTRSDTATYIIEAVNTSGRATAVVEVNILDKPGP
PAAFDITEITNENCVLTWNPPRDDGGSRVTNYIVHFKEGASEVWKKLSTTIKDTKYKAMN
LTPFKEYVFKVCAENMYGIGEPSEHAPIVARYSFDPPGAPTHVQPSDINKDSLTLSWNEP
DEDGGSPITGYWIEKFDPETDKWMRCNKIPIRDTTFRVKGLATKKKYKFRVLAENLAGPG
SPSKETEPILVKNPIDPPWPPGKPSVKDVMKTTVFLMWTKPEHDGGAKIESYIIELLKNG
TEDWVRVAEGVPMTEYFLKGLMDKQEYSFRIRAVNKAGESEPSEPSDPVLCKERLNPPSP
PRWLEVVNITKNTADLKWTPPERDGGSPVTNYIMEKRDVRRKGWQTVDTTVKDIKYTVTP
LSEGSLYVFRVAAENVAGQSDYCELEDSVLAKDTFTTPGPPYALTVLDVTKRHVELKWEA
PKNDGGRPIQRYVIEKKEKLGTRWVKAGKTAGPECNYRVTDVIEGTEVQFQVRAENEAGC
GHPSEPTDMLLIEDPTSPPSPPLELHVTDASRGHISIAWKAPEKNGGSPILGYHIEICEP
GTEKWMRINSRPVKDLKYKADEGIKPDKEYILRVRAVNAIGTSDPSEISENVFAKDPDCN
PSIEVKSQDVIVVEGERLNVPLPFRAVPAPTVSWHKNGRELKADDRITLKSDYISACLEI
ARSVHADAGVYTLTLENKLGSTIGTINVKVIGLPGQCKNIKASEVTKDSCKITWDPPDND
GGSPVLHYVLERRESGRRTYMPVMSGENKLSWSLKDLIPNGEYYFRVKAVNKIGGGEYTE
LRNPVIAEDPKQRPDPPVDVEDHNPTSKSVTLTWKPPLYDGGCKIMGYIIEKIPKGSDKW
ERCNEYLVPVLSYTVKNLEEGNEYQYRVRAENVAGVSEPSKLTLGIKAVDPVERPKVFLS
GNLASGLSVKRGDQISLNAVISGSPYPSVTWIKDEEVIRPEEIKKRERKIMPVKKKQEVV
EEEPFFLSLPERLSLDNSRQGESNIMVRDSIRQDHGKFTIKVENDHGIARATCYVNVQDT
PGPPINFTFEEIRSDSLRCTWDAPVDDGGSEILNYILEKKDYSKPEAGWITISSTLRQRK
FHITKLIEGKEYIFRVTAENKFGPGPPCLSQPVIAKNPFEPPEAPEKPEVVDTSSNSMVA
EWKEPKDNGSPIIGYWVERKEISSTHWTRVNRQLLNALTTKAEGLMEGLTYIFRVCAENA
AGPGKFSPPSEPKIAQDPVLPPGPPRPRILDTSETTIEIEWDPPIYSGGGDIIGYHVDKQ
MLGSKEWSRCTERLVKNRTLSVSGVREGGDYKIRVVAVNNAGEGPPGETETVTVRDPKEP
PVVEFDISVKAGVQHLAGKTIRLPAIVTGRPPPEIKWSKEEGELDKERILVETVGTSTVL
VIQDARRSDHGRYMVTGTNSSGSKSAVTRVEVMDVPGPVLDLKPVVVTRKMILLNWSDPE
DDGGSDLTGFSIERKDAKMHTWRQPIETDRSKCDIVGLLEGQEYMFRIIAKNKFGGGPPV
DLGPILAVDPLGPPTSPERFMYTERTKSTVTLDWKPPRNDGGSPIIGYIIEKKKQDTPEF
DRVNKQLCRATNLLVENLAELHMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTVKLLV
KIKRNTISVKAGEPIDIPAEVEGLPLPKIEWKKGETVIGASTDQLKMHTEILSRTNAKTK
IHIAASVRKDTQLYTITGSNRLGTAFQSVNVVIFDKPSPVRKLVVSDIKSESCYLTWDAP
EDNGGSEITNYIIDKRDASKKKSEWEEITNFIIERRYGVWKLTTDGDYQFRIRAQNKYGI
SDDCVSEKVTIKDPFGLPGPPAKPKVSDVTRLTMLVSWEPPLNNGGATITGYWLEKRELG
GVYWSQVNRAPVTKPSVKGLDFNVLRLIEGLEYQFRVMAVNAAGIGPPSEPSDPVLAADP
IYPPSTPSALEVTDKTNSTVALRWKRPDKDGGSPIKGYIVEMQEEGSSDWKNVSEPDKLL
TNCEYEVPNLQTHKKYRFRVKAVNAAGESEPSSTTTEIVVKDLLEEPTVSLAINAQDLLL
CRAGTTVKIPVIVTGRPFPKLNWEFEGPAKTVLKDDIHNLPADAELESTKTTTTVVIPEC
NSSHSGRYSITAKNKAGQKTLNIRVNILDAPGPPKNLKVSDITRSTCKLSWKPPDNDGGD
RIKAYYIEKKTVEGRAWVKVNTACAGTSYTVPDLVEGQEYFFRVRAENRFGVGAPAETIQ
RTRARDPIHPPEPPTRLKIALVTKNAVSLTWRPPKNDGGAPVTHYIIERLSWTTTGKDKE
SWKQCNRRDVDDTKFTVEDLQEGGEYEFRVKAVNEAGQSKPCNPVGPIIVKDQTCGPSIE
LKEFLEAEERTDISIVAKIKGVPFPTLTWCKAPAHKAEEKSKVEYDQHVNKIVTEDKCTL
LIHQSLRKDTGLYTLTATNNLGTDSKEMRLNVLGRPGPPVGPIKFEGISAEHITLAWLPP
KDDGGSKITNYVVEKREANRKTWMEVTNEVKECLCSVPKLLEGHEYVFRIMAQNKYGVGE
PLDSEPETARNLFTLPGACDKPTISSVTHDSMIVNWEDPEYDGGSPVTGYWLERKETTGK
RWNRVNRDPIRIMPLGVSYNVTGLIEGSNYQFRVFAINAAGIGPPSQPSDPTIARDPIAP
PGPPFPKVTDWTKSTADVEWDPPTKDGGSRITGYFVEFKEEGKEEWEKAKDKEVRGTKFV
VSGLKEGGLYRFRVRAVNAAGVGAPGEISDALEVKDRTEIPDIELDASVRERIVVHAGGV
IRIIAYVSGKPPPQITWHRNDEAVPAEATIEVTAISSALVIKKCQRSHQGIYNLVAKNVG
GERRKTIIVDVLDVPGPVGVPLNFENLTNDSGKLIWFTPDDDGGSAITNYVIEKREADRR
GWTPVTYTVTRQNAVIQNLMKGNAYFFRIAAENLIGKGPWVETPYEYIIKEPMSVPDRPE
ELQVTGVTRNSVSLSWNPPKYNGGSDITMYIIESRLIGKDKFIRITKDKLLNRKYTSDGL
KEGDTYEFRVSAVNVVGQGKPSFCSKPITCKDELVPPTIELDFRDKFVVRVGECFSLNGR
YAGKPAPKVSWLKDETKITDTDRLKIQTTPKTLCLGILKGIRADSGKYCVVVENSTGTRK
GVCEVTVVDRPQPPVGPVVFHEVHRDHMVISWNPPLDDGGSVITNYVVEKRDTNRDLWMP
VTSAVTKTTCKVPKLIEGREYIIRISAENMYGISDPLESEEIKAKDRFRVPEAPEQPVIK
DVTKDSVVVIWNRPRDGGKPITNYIVEKKETMSNRWSKASTEPIYPDTKYKVTDLYEGCE
YEFRVSAVNEVGVGDPSPPSKPVFAKDPIVKPSPPVTPEAVDKTKSTVDLIWLPPRHDGG
GKIIGYLVEYQKVGDEEWTKANHTAESCPDLKFRVTGLTESYMYKFRIMAVNVVGESEPV
YVRDPVEVKDRLEAPELFVDANMARDLNIRAGSDLTLSAMIKGMPFPKVTWQKEDKEVPM
KADIGVTPVGSKLQICNAVRGDSGHYSLTVENEAGKKSATCNVFVLDKPSPPHTFTVTEV
RSNSCYLMWKEPIDNGGAVISNYIIEKRDVSAPQWVPISSSSKKHSIMAKYLMEGTQYLF
RVAAENQYGRSAFVETKKPIKAIDPLSPPGPPKNLHHVDVDKTEVSIVWNYPDRDGGAPI
TGFLVEYQEEGAQDWITFKTVSIPECTVTHLEEGKIYRFRVKAQNIVGFGRPDTTVPVLC
QEKIVPPTIDLDVKLIEGLVVKAGSTVRFPALMKGIPVPSVKWVIDSVVIKSEGHYKINT
DGHSTILTIEECNRKHSGEYLLTVSNPAGSKTVALHLTVLDVPGPPIGPANILEVTPEHM
VVSWRPPKDDGGSPVMNYVVEKRETKKETWGIVSSGSTSTRVKIPRLQKGCEYIMRIRAE
NKIGIGEPLDSLPTVAKHTFDVPSPPGKPVVYDIAENAVTVSWGLPKSDGGSPINGYILE
RREISGKWIRVNKTPVLDIKFRAVGLFEGNSYQFRVFAENIAGLSKPSPNSDTVAAKRPI
TAPGPPINPKLKDKSRESVDLVWIKPNKDGGSPILGYIVECQKTDSTKWIRVNKDDLIPQ
CAYRAHGLIEGNEYRFRVKAANVIGEGEPRELPETVIAKDILQPPEIDLDIVCRELVTVR
VGQTICISGRVKGRPDPDITWSKDSKVVSPDKRTEINNDYPIIRLHIKSATRADYGKYSV
VAKNSSGQVQAAVVVNVLDRPGQCQNIRTNYITKDSCMLAWDNPEDNGGSEITNYIAECR
QPSQRGWSMISADLTKRIVKVQLVPNQEYFFRVCAENKVGLGPTVETKTPILAIDPVEKP
GAPENFHVAETGKSFAQLKWRKPDFDGGSPNLSYHVERRLKDTDEWDRLHKGSIKDTFFM
ADRCIENQTYQFRVQTKNDGGESNWVKTDYIVIKEEIQKPVLDLKLSGILTVKAGETIRL
DADLRGKPAPEVTWVKDKDAIDFARLPRAKIEITPESARFALIKAKRSDSGKYTIIATNI
AGSFTAYAIVHVLDVPGAVRDLKISAIASDRCRVSWDAPEDDGGCEVQNYVIEKCETKRM
IWSTYSTSVLNEYANVTRLIQGNEYIFRVRAENKMGTGPPTESKPVTAKTQFNRPGPPDA
PEITKASREEMTVVWNPPEDDGGKSITGYILERKEKLSIRWVPITKTAITERRMRVKNLT
PGREYQFRVKAENEIGIGDPSGPSRPVFAKDPMEPPGPPTGLKVSDSTKTSVTLSWGKPV
YDGGSPIIGYVAEMRLKGSSEGPEEGWKRCNVAAQLVLTQFTMTGLDEKQEYEFRVAAMN
QVGLGRPAELKEAVSPKEILEPPEIDLDASLRKVVVVRAGCPIRLFATIRGRPAPRVCWR
KMGIDNVVRKGLVDLLDTMAFLVIPDSTRDDAGKYSLTLVNAAGEKAVFVNVKVLDTPGP
VSDFETSDVGKMTCQLSWSPPDNDGGSPVTHYILEKREADRKTWASVIPDLKKTSFKITN
LVPGNDYYFRVTAVNQYGSGVPKDTAKSIVARDPISEPDPPKKVEVTDGTKSSATVAWLK
PLRDGGSKIDGYIVEYQEEGQTEKEWTQYSVVKDLSIVVMGLKEGKKYKFRVAARNIVGS
SLPRETEGFFEVKEQLMAPKIIMAENITIKAGKKLRVESHIFGKPAPTFKWQKNDEDVMP
SSRLAVHKSKGASVLIIKDVSRSDSGFYNLIAENSSGIASQKVHVVIMDAPGPPEPPFDI
TEIDADACTLAWHTPHENGGSNITNYIVEKCDLSRGDWITSVSSVSKTSCRIGKLMPGQE
YMFRVRAENRFGISDPLTSGKMIAKYQFDIPTEPRNVHLTKVNKDCIFVAWDRPESDGGS
PITGYVIERKERNSLLWVKANDTAVRTTEYPCSGLIEGLEYTFRVIALNRAGASKPSKPT
EFVTARTPVDPPGKPEVFDITQSTVALLWARPKHDGGSKILGYFVEACKLPGEKWIRCNS
NCHNVPLEEYTVTGLEEAAQYRFRIIAKTVINISKPSEPSDPITIQAEHDAPKIDLGVSM
KSLMTVKAGVNVCLEAVVSGKPFPKVSWKKNGNEVVPADGFKITTTRSLCTLELYSVQRK
ETGEYSIFAENPSGSKSAHVKLKVLDKPGPPASVKISNVYSDRVNLSWLPPLEDGGADVT
NYVVDKRETSRPNWAQVTANVPITSCGIEKLIEGHEYQFRICAENKYGVGDPILTESVVA
KNPYDVPGQCDPPVISNATKDHMTVSWKPPADDGGSAITGYLLEKRETKVVKWSKVNRRP
VMERTVKATGLQEDLEYEYRVIALNKAGPGKPSESSKSAIAVDPQYPPGPPAFPKVIDTT
RGTVSLSWSKPAYDGGSPILGYLVEIKLADTENWMKCNVPKNLQETRYIVTGLNDSTEYQ
FRVSAVNKIGFSDPSDVPDKHIPKDILIAPEADLDADLRKALILRAGVTMRIYVPVRGRP
TPKVTWAKMNTNIKEREGLEIRTSEYDTMLYCENVNRYDGGKYILTLENSSGMKTYTLVV
KVLDSPGPPLNLVVKETSKNSAAISWDPPLVDGGSPVKNYIVEKRDAERKAWSTVSTECP
KTSFRIQNLEESKFYFFRVLAENEYGIGVPCETKNAVRASEEPGPVINLKALTLTKSSCT
LAWKKPASDGGSRITAYVVEILLAGDKWKELMQSKNMQHPIKDLEEGKEYTFRVRALNDA
GYSPPEEITVVAKDQVVPPNIDLRDLPDLTYVAKEGSSFRLKIPISGKPVPKVTWKKGED
PLLDESGRVVVESTAVNTTLIVRECQKSDASKYTVTVKNTAGTKEGTLFIKIVGKPGIPT
GPLRFDEVTADAITLIWGAPKDDGGSEVTNYILEKRDNTTNKWVTCASAVQKTTFRVTRL
HEGIEYTFRVSAENKYGVGVDLKSDPVIARHPFDVPDAPLPPQVVAARHDSVSLVWTDPR
KTGGSPITGYHIEYKERNGLLWKRANKTPLRMKDFRVTGLTEGLEYEFRVMAINLAGVGK
PSPPTKPVTTLDPIDPPGKPDVINITRNSVTLMWTEPKYDGGHKLIGYIVEKRDLPSKIW
MKANHVNVQDCAFTVTDMTEGCKYDFRIKAKNAAGAISEPSETTGTIVCKDEYEAPTIVI
DPTVKEGLTVKAGDTIVITATSILGKPPPKSAWSKGGKYFKPSDIVQIEDTPTSSILSVK
YATRKDSGEYTITASNPFGIKEENVRVKVLDVPGPPGPIEVSNVSSEKVTLSWSPPAEDG
GSPVKSYTIEKRETSRLLWTLLAENLPSCRYVASKLIQGNEYIFRVSAVNQYGIGDPSHG
EPVKMVDSFGPPGPPGKPEITNVTKNTVTICWKRPVDDGGSEILGYIVERKEKKGLRWVR
TSKKSISDLRHKAVGLNEGTEYEFRVTAENKAGIGTPSEPSASVLTKDLAYVPGPPSNAR
VVDTTKTTATLTWGKPHYDGGLDIIGYIVEHKKEAEEEWVKDTTGTALRITEFVVANLQP
GEKYHFRIRALNAEGIGEPAQVDGAVEIKEREEVPDFELDADLRRTLVVRAGVTIRIFVP
IKGRPTPQVTWLKGDSPVKGRATVETTSSYTFLLIPESTRDDTGKYTMCLENAAGKKSGF
VNVRVLDSPGPPINLKAREVTKDSITLAWELPMIDGGSRVKNYIIEKRESTRKAYATVTT
NCQKCSLRIPNLSEGSEYYFRVMAENEYGIGEPAETTDPVRASEAPSPPESLHIMDITKH
TVSLAWPKPEFDGGSRITGYVLEAQKRGSEKWMPLATQKALDYTVKNLTENEEYTFRIMA
VNISGRSDPRESRPVVVKEQTSLPELDLRGIYQKTIIARAGDNIKAEIPVHGRPKPTVTW
TKEGQTLKQTQRINVENTANSTILNINECTRNDTSKFTLTAKNIIGEVSDTISVQVHDIP
GPPKGPIKLDDISSVYILMSWEPPESDGGVPINNYIVEMRETNSTSWVELAATVIRTTFK
ASHLTTGMEYQFRIKAQNRYGVGPAIISESVVAAYPFKVPGPPGTPSVIGVTKDSMTITW
NDPVTDGGSQILGYHIERKERNSILWQIISKALIAGNTFKSSGLTDGIAYEFRVAAENMA
GKGKPSKPSDPVFALDPIDPPGQPIPVNITRHSVTLVWTKPEYDGGFKVTGYTIEKREFP
SGRWLKANFSNVLETEFTVSGLTEDDKYEFRIIARNSAGAVSKPSEPTDAITCRDDVEEP
RIMVDAKFKDVILLKAGEVFKLEADVTGRPIPTMVWTKDAKDLVEMGKQEIKITDFSTVL
MNKDSSRKDGGAYVLTASNPGGSVKHVFNVKVLDRPGPPEGPIGITDVTSEKCVISWLPP
PDDGGAKIDHYVIEKRETSRLAWTTVSADVQVTKLKINKLLKGNEYIFRVMAVNKYGVGE
SLESEPVIAANPFVPPSPPKTPEVTAITKDSMVICWGHPDSDGGSEITNYIIERRDKTGL
RWVKCNKRPVTDLRFKTVGLTEGHEYEYRIVAENAAGLSQPSSTSPFYKSCDTVFKPGPP
GNPRLLDSSKSSITIAWNKPIYDGGSEITGYVVETCLPEEDEWTIVTPQAGLKATSFTIT
KLKENQEYLVHIYAVNVEGIGEPAQIPGTVKAEDRLLPPEIDLDADLRKVVCIRACCTLR
LFVTVKGRPVPEIKWAREDGEPLDRASIETTSSYTLLIIPNVNRFDSGKYMLTVENSSGS
KTAFVNVRVLDTPGAPQNLKIKEVSKESVTVSWEPPLIDGGSKINNYIVEKRESTRKAYS
TVIANCHKTTWKVGTLQEGCNYYFRVLAENEYGVGLPVETSDAVKVSERPLPPGKVTLVD
VTRNSAILSWEKPEHDGGSRLLGYIVEMQSKGSEKWTTCATVKLTEATITGLTQGEEYMF
RVSAQNEKGVSDPRQLGVPVIAKDLIIVPSFKLLFTTFSVLAGEDLKVDVPFIARPKPTI
TWLKDNQPLKQTTRVNAELKDSKALLVIKEACRDDVGHYTIKLANAAGETIQILGIVVLD
KPGPPTGPIKIDGVTADSMILTWEPPEYDGGCQINNYIVEKRDTSTTVWQIVSATVARTT
IKAIRLKTGIEYQFRIAAENRYGKGSFLVSESTVAQFPYKSPGPPGTPYMTHVTKESMLV
QWNEPVNDGGSRILGYHLERKERNSILWIKMNKSIISDTQMKSSNLEEGIEYEYRVYAEN
IVGIGKPSKVSECVAARDPCDPPSRPEAVIVTRNSVHLQWNKPEYDGGSKIIGYIVEKKE
LPEGRWMKASFTNIIDTNFVVTGLMEDQRYEFRVIARNAAGVFSEPSESTGPITARDEVD
PPRVSMDPQYREAVVVNAGEVFKIEADIFGKPIPTIQWLKGDKELENTARLEIKSTDFNT
ALTVKEAIRVDGGQYTLLARNVAGEKIVHVTVKVLDRPGPPEGPIVVTGLTAEKCTLAWK
PPTQDGGSAISHYVIEKRETSRLVWTVVDSNVVALSYKVTKFLEGNEYIFRVMAVNKYGV
GESLESEAVIAKNPFVPPDAPKTPEVTAITKDSMVVVWGRPTSDGGSEIHGYILEKRDKA
GIRWTRCNKRLVTELRFRVTGLMEYHDYEFRVSAENAAGISVPSLSSPFYKAADPIYKPG
LPNNPKVTDVTRSSVSLSWSKPIYDGGCEIQGYIVEMCDTSTDEWIMCTAASGIKQTQFQ
VNKLVEKHEYKFRVCAVNKAGVGEHADFPDTVLLEDKLEAPDADLGADLRKIINVRAGCS
LRLFVPIRGCPAPEVKWTKSDGEIRDTAQIDVSESYTMLVIDNVNRYDTGKYMLNLENSS
GSKSAFVSVRVLDTPSPPINLKVKEVTKEHVTLSWEPPKLDGGAKIKNYIVEKRESTRKA
YSAVVTNCHKTSFKIEQLQEGCSYYFRVCAENEHGIGLTAETVDPVKISEVPQPPGKITV
VDVTRNSVSLSWEKPEHDGGSRIIQYVVEMQSKGSEKWAACAHVKSLETVITSLVQGEEY
SFRVMAANEKGKSDPRTLAVPVIAKDLVIEPDVRPAFNSYNVQVGHDLKVEILISGRPKP
VIIWTKDGQSLKQTTRVNVADTSHHTVLSIKDSVKEDSGMYAIAVSNIVGQKTASFEVIT
LDKPGPPSGPVKFDAVSAESITIAWEPPAFTGGCQISNYAVEKRDTTTTTWELVSATVAR
TTLKITKLKTGKEYQFRIYAENRYGRSFALDSQAIIAQYPYKEPGPPGTPFVPNATKETM
IVEWHEPINDGGSRIVGYHLERKERNSILWSKVNKSIIQDTRLKITGLEEGIEYEFRVYA
ENIVGIGKSSKISECFVARDPCDPPGCPEPLIVTRNAITLQWTKPEYDGGSIITGYIVEK
RDLPEGRWMKASFTNIIETQFTVTGLTEDDRYDFRVIAKNAAGTISKPSDSTGAITAKDE
VEPPRISMDPKYRDTIVVNAGDVFKLDADVHGKPLPVIQWFKGDKEVEESARHEIKNSDF
KALIVVKDAIRVDGGQYILQVSNVAGTKSVPINVKVLDRPGPPEGPIQVTGVTAEKCSLA
WSPPQHDGGSNISHYIIEKRETSRLAWTVVTSDLQTTMHKVTKLLEGNEYIFRIMAVNKY
GVGEPLESIPVMMKNPFVPPSPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRD
RAGIRWTKCNRRRITDLRFRVTGLVEDHEYEFRLSAENAAGIGQPSPASVFYKACDPVFK
PGPPANPHLVDTTKTSVVLVWGKPIYDGGCEIQGYLVEIRKADEEDWTMCTPQTGLRVTR
FEIGKLIEGQEYNVRVCAINKAGVGEPATVPGAVKPEDKLDAPEIELQAELRKGITVRAG
NTARIFIAFKGRPAPEISWSKDEGEMNEKGQVEKGHNYTQVTIDNCDRNDAGKYILTLEN
SSGTKSAFVSVKVLDTPGAPQNLAVKDIKKNSATLTWDPPIIDGGAKIKNYVIDKRESTR
KAYANVTTKCNKCSYKVENLAEGAIYYFRVMAENEFGIGIPVETLDSVKASEVPLPPGKV
TLTDVTQQSVSLAWEKPEHDGGSRIMGYLVEMQPKGSEKWGLVSQSKTCEAVVAGLSSGH
EYLFRVLAFNEKGKSDPRLLAVPVIAKDQNIEPTFKLVFNTYSVKAGDDLKIEVPVMGRP
KPKIIWAKDGQSLKQTTRVNVEETATSTILLIKDSHKDDFGKYSVSATNSAGSATEDISI
IVLDKPGPPSGPIRFDEVSAQFVIISWDAPEYTGGCQINNYIVEKRDTTTTAWQIVSATV
ARTTIKIMKLNTGSEYQFRIFAENRYGKSSSLDSKAVVAQYPYKMPGPPATPIVSAATKD
TMHIQWNEPVNDGGSKILGYHLERKERNSILWIKLNKVIIQDTHFKCNNLEEGIEYEFRV
FAENIVGISKPSKVSECYVARDPCDPPGRPEAVIITRNNIVLQWTKPPYDGGSKITGYFV
EKKELPEGRWMKASFTNIIETEFNVTGLTEDARYEFRIIARNAAGIFSEPSESTGPITAR
DEIESPRASLDPKYKDVIVANAGDSFALEADIYGKPIPEVKWMKDGKDLEVTTARMEIKS
TLHKTALTVKDCIRIDGGQYTLHLSNVGGTKSIPITVKILDRPGPPDGILKVSGVTAEKC
YLAWNPPSQEGGANISYYIIEKRETSRLSWTQVETNVQAISHKVTKLLPGNEYIFRVMAV
NKYGIGEPLESEPVVAKNPFHVPGPPTTPEVTSITKDSMVVTWGRPTDNGGAEIEGYVLE
KRDKDGIRWTKCNKKRLTDLRFRVTGLVDGHFYEFRVSAENAAGVGDTSEPSIFYRACDA
IYPPGPPNNPKVTDTTRSTVSLAWGKPIYDGGAQIRGYSVEVKEASTEDWITCTPPTGVQ
STYFTVEKLKENIEFNFRVCAINCEGVGEPANVADTIIAADKLEPPEIELDADLRKIVSV
RASGTLRLFVPIKGRPEPEAKWEKAEGNLSERTQIEVTSSYTMLVLDNVNRFHSGKYHLT
LENNSGTKSAFVNVRVLDTPSAPVNLHIREIRKDCVTLSWEPPLIDGGAKITNYIVEKRE
STRKAFASVTNNCTKTTFRVESLQEGGIYCFRVLAVNEYGTGLPAETAEPIKASEVPLPP
GKVTLIDVTRKTATLTWEKPENDGGSKISSYIIEMQTKGSEKWTLCAQEKTLETTVKGLT
AGEEYTFRVIAVNEKGKSDPRLLGVPVVAKDVEIEPSIELAFNSFSVKAGDDLKVDVPFR
GRPLPTVTWKKDGQSLKQTTRVNVQTSKTSTLMTIKEASKEDVGKYELIVSNSTGSITSL
INVIVLDKPGPPGEIRVDDVSADNITISWDPPEYDGGCQINNYIVEKRDTTTTTWEMVSG
TVARTSIKITRLKPGSEYQFRVCAENRYGKSHNKDSHGIVAQYPFKPPGPPSTPIVAHAT
KNYMIVKWNEPVVDGGSKILGYHVERKERSSILWTKVNRGLVTDTKIKVTSLDEGLLYEY
RVYAENIAGIGKCSKVCEPVAARDPCDPPGQPEVTNITRTSVSLSWTKPEYDGGAKITGY
IVENKELPDGRWLKCNFTNIPETYFDVTGLTEDQRYEFHVIAKNSAGLFSEASESTGPIT
VKDDVEAPRIMLDAKFREIVIKAGELVKVNADIAGRPLPVVSWTKDGKELEGQARTEIQS
TDKSTIIIVKDCNRRDSGQYVLTLQNVAGTRSLAINLKVLDRPGPPAGPLDVSGLTAEKC
SLKWAPPQENGGAAIDHYIVERRETSRLAWTLVTDELRTTSCKVTKLLRGNEYIFRVMGV
NKYGVGEVIESEPRKALDPFTIPSAPKSLEITNVTKETMTICWSRPDSDGGNSIAGYIIE
KREKNGLRWVRVNKKPVYDLRVKATGLRESAEYEYRVSAENAAGVGPASEASTLIRAEDP
LFVPAAPSKPKVVDSTKTSISLAWTKPLFDGGSPVTGYTVQYKKSEETEWTTAIQNLRGT
EFTVIGLTSGAEYVFCLSSINKVGVSDPSEVSEPQVAKEREEEPAFDIDNEMRKTLIVKA
GSSFTLAVPFKGKPIPNVMWSKSNVDLRVRGSIDSKDLMTSLTIEKATRNDSGKYVLTLQ
NVLATATLTLVVKVLDSPGPPGAIIPKEVTRDSVLLTWDVPENDGSARVKNYHIEKREAS
KKAWVCVTMNCNRLTYKVTNLQEGAIYYFRIRGENEFGVGVPIETKEGVKVTEKPSVPQR
LGITNVTKDSVSLAWSKPEHDGGSRITGYFIEALEKGQQKWVKCAVVKTTHHIIEGLREN
GEYFFRVSAQNQAGLSDPKEMVLPVTVKEQLDSPEINLKYFPHNTVYVRAGSNLKFEIPI
SGKPQPKVSLSRDGLVVKSTMRFNTEMSAESLIVNLRESVANDAGRYDITAANSSGTTKS
FINIVVLDRPSPPLGPVNISDVTEDSVILKWHPPAYDGGSQVTNYIVLKRETSTAAWSEV
SATAARSIIKVMKLTTGEEYQFRIKAENRFGISDHIDSASVMVKLPYTTPGPPSTPWVTH
VTRESISVGWHEPVSDGGNQVIGYHLEMKDRNSILWQKTNKTIIRTTHMKITHITGGLIY
EFRVYAQNAAGIGKVSHLSDPVLAIDACEPPTNVRATDVTKNAVSLSWKKPAYDGGSKIT
GYIVEKRDLPNGRWTKGSFINVIETLFSVSGLTEDAQYEFRVFAKNANGSISNPSDVLGP
VTCHDTYGAPQIDLPMEYLDIVKYKADSAVKLKVGISGKPFPSIEWYKNEKELETSAQVS
IESTTESAAVLIKDASRINSGNYEIKLKNSMGSGTATIRVLILDKPGPPGGPIEFKTVTA
EKITIMWNPPEDDGGASISHYIVEKRETSRVAWSLITDKLETCMISMQKLIKGNEYVFRV
RGVNKYGVGEPLESDVVIAKNAFVTPGQASMPEATMITKQTMTITWTRPTVDGGNEIIGY
FLEKREKRSLRWFKVIKEPIRDTRQKVSGLTEGNEYQFRVSAMNAAGLGPPSDISDFYKA
ADPVDPPGEPTKLKIVDTTKSSITLSWTKPVYDGGSTITSYVVEKKEAEEEEWTVVSAKG
EVRTSEYVVAHLQPGINYYFRVSAVNIAGHGEPIEMTEPVQAKDILEGPEIDLDVVMRSS
ITVKAGEDVEIMIPFKGRPTPNVTWRKGEKLINGDEKYIIHNTESTTFMTIPQVSREDSG
KYVLTIENGVGEAKSTFVTVKVLDTPGACQNIQIKHVTRSTVTLIWDPPLVNGGSAICNY
VIEKRDATKRAWSCVTTKCCGTMFKLTNLSEKTSFFFRVMAENENGLGVPCETTEAVKAT
EVPGPVKELAMKDSTKTSVVLQWNKPDYDGGSIISDYIIEKKLKEETEWSSAGTCKVCEF
EATKLKELTAMDFRVFAKNEKGLSDSVTIGPITVKDYVITPEADLSEIPGGQISVRIGHN
IHIELPYKGKPQPSIQWLKDNAPLKETEFIRYKKTATKATLNIKNVKKEHGGKYTLILEN
AVSRKSFSITVFTLGPPSKPKGPVKFDEVKADSVIVSWDVPDDNGGSEITCYSVEKRETS
QTSWKMVCSSVTRTSFKVPNLVKDLEYQFRIRAENRYGISAPLNSMDVIAKHQFRPPGPP
GKPVVYNITCDGMTITWDAPVYDGGSEVIGYHVEKKERNSILWQKVNTAYISGRDYRIIG
LIEGLDYQFRVYAENSVGLSPVSELSKLHLAVSPVDPPGTPDYIDLTRDTVTLKWDAPLR
DGGSKIVGYCVEKRQASGRWLRCNFIDVSECQYTVSGLSPGDRYEFRIIARNAVGTMSPP
SQSSGYIMTRDESISPTIEFGAEHFEGLTVKSGEAIRMKVHIKGRPLPQVTWFKDGKEID
KKLMVDITNVIGSSSVFVRDASRDHRGVYTVEAKNASGSKKADITVRVQDTPGKPIGPIR
FSNITGEKLTLWWEPPDNDGCAVITHYVIEKRETSRIAWSMVSDNCEACSFSVTKLIKGN
EYQFRISSVNKFGVGRPLDSEPVIAQIQYTTPDPPGTPEPTYVTGDSITVTWSRPRSDGG
NEIKQYILERREKKSMRWVKVFSKRTITETRYRITGLTEGNEYEFRVTAENDAGVGPSSE
ISRLVKCREPVNPPGAPTVVRVTDTTKTSVSLEWTKPVFDGGMPIIGYIIEMCKTALGNW
NKVNAEACVNTKYTVTELEATEEYTFRVCAVNSAGKGDSCEVASAVQAVDRLTSPEIDID
ASFKQIHIVKAGGTVQLSIAFQGRPVPVVTWSKADSSIGIHAHINTTDTFSVLTIENCNR
YDAGKYTLSLENNSGSKSITFTVKVLDTPGAPGPITFKDVTRGSVTLMWDAPVIDGGSSI
RHYIIEKHEASRRSWQEISGKCSRQILKIGDLAEGVQYYFRVMAVNEYGVGEPYEMAEPI
IATEEPAPPKRLDIVDTGKTSADLAWMKPEHDGGSRITGYLIQMKQKGSDHWVDACNTKL
LQVTVDGLVENTEYEFRVQAKNDAGYSEPRESFSSVIIKEPRIEPKADLTGITNQTITCK
SGSSFTIDVPISGRPPPKVTWKLEEMRLKETDRVSIKTTKERTTLCMKESLRGDSGKYYL
TLENTAGVKTFTVTVNVIGRPGSVTGPIEISSVSAESCVLSWQETEDDGGAEITNYIVEK
RESGTTVWQLVNSSVKRTQIKVTRLTKYMEYNFRVSAENRFGVSKPLESAPIVAEHPFVP
PSAPTRPDVYFVSSSAMSVRWEEPYHDGGSKVNAYWIEKKERNSILWVKENKIPCIECHY
KISSLVEGLEYQFRIYAMNKAGLSKASEASRPQIAQNPVDPPGRPEVTDVDNSSVSLKWT
VPINDGGSKIVGYVVERKPYSETGEGRWLKCNYTSITDTFYTVSGLSEAEVYEFRALAKN
ASGVISIPSESTGPVTCRDEYIPPKAELHTRLLGEVVTIRAGSDLVLDAFVGGKPDPKVF
WSKGDKELELCEKISLQYTNKRAIAIIKFCDRSDTGKYTLTVRNPSGIKTVSVNVKVLDS
PGPCEGSITISRVTEEKCTLTWNMPLEDGGAEITHFIVERRETSRLNWAIVEPECLTLST
VASRFVKNNEYIFRVRAVNKYGPGVLLESGPVVARNLFTVPSQPGEPQFVAVGKEHIIIQ
WMKCETDGGAEIRNYLVDKREKRSVRWTRVNRDYTVYDTRLKVTGLMENCEYQFRVSAVN
AAGNSEPSESSQYILCKEPTYTPGLPSAPRVVDTTRHSISLAWTRPMYDGGSDIIGYVLE
MKEEGTEQWYRAHTTSSLRNTEHTIASLVTGKKYFFRVASVNINGISEFSESSAEIETVE
RIAIPDLELDDDLKKTVTVRAGGSLRLMVSVSGRPAPIINWSKSGVDLMSRGFIDTTDSY
SLLIIDKVNRYDAGKYIIEAENPSGKKAATIVVKVYDTPGPPGVVKVKEVTKDSVVLTWE
VPLIDGGAPINNYIIEKREAAMRAFKTVTIKCNKTIYRITGLHEGSMYYFRVLPENIYGI
GEPCEVADSVLVSEVAMVPQKLEVIDVTKTSVTLAWEKPLHDGGSRLTGYVIEACKAGTD
RWMKVATVKQTVFQHTIISLNENEQYLFRVHALNAKGMSEAREIVTAVTVKEQKVVPTID
LVGITQKTVSVHAGKPIELVIPIGGRPYPAASWYFAGNKMREGDRIKMEKSAKVVKLTVR
ETTISDTGDYMLELKNTAGTTTESIKVIILDKPGYPTGPIRFDEIDATSVTISWDPPEKE
GGATITGYVVEQRDAHRPGWLPVSESVTRTMFKFIRLIEGTEYVFRVAATNRFGIGSFLQ
SDIVQCKSAIDTSEPPDTPQVFDISRDGMTITWDVPVEDGGSQVTGYIIERKELRAERWV
RVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGESKPSRPTKPAIAMDPIEPPEKPQNP
RVTDTTRTSVSLAWNPPEEEGGSKVTGYLIQMQKIDQFEWTKCNTTPTKICEYTLTHMPQ
GAEYRFRILAVNAGGSGEPADVPGTVKVTEMIAYPDYELDPKYMEGLLVRQGGVIRLTVP
IKGKPIPVCKWTKEGRDVSHRAMIASSDTDTELVIKEADREDSGTYDLVLENKCGKKAAY
IKVKVIGIPNRPEGPLEFDDIQARSVRVSWRPPTDDGGSDIIAYIVERREVPKTAWYTVD
CTVKECSIVVRGLKENIEYHFRVSAENNFGISQSLKSEEPVIPKTQLNPPEPPSNPPEIL
DVTKTSVSLSWARPKDDGGSRVTGYFIDRKESTTDKWVRQNKTQITTTMYTVTGLVPDAE
YQFRIIAQNDIGSSEPSQASDSVICKDPFDKPSQPGEIEIISVTKDSIAIKWERPECDGG
KDIIGYWIEYRQSGDSAWKKCNKDRTKDRQFTQGGLLESTEYEFRVFAENETGIGRPRRT
PVAIKTKLTSGEAPAVRQEVKDVTAKLGETATLSCQIIGKPLPDIKWYHYTKELIQSRKY
KMSSDGRNHSLTVKTEDQEDEGSYTCKATNDAGETELTGKLLLQAAPMFHSGFPLKEKYI
VGSGTSLRIHVVYIGRPVPAIHWFHGKKPLAVSETVLIENTENYTHLVIRNVQRKIHAGK
YKVQLSNVFGTVDTILNVEIQGKPDMPEGPIVMDAFLKNSAVISWKPPIDNGGAMITNYI
VEKREAKEGETWKLVSSAIAGTSCRIVNLIDNAGYYFRVSAQNQFGVSQALEVSAIVIIK
SAFGKPGVPSKPTVAAVTKDSCVVSWKPPTSDGGAKIRNYYLEKREKKQNKWIAATTDEI
RETVYSAEGLIEGLEYEFRVKCENLGGESDWSEVSEPIIPKSDVPIRAPQFKEELRNLNI
KYKGNATFVCKITGNPKPIVKWFKQGKEIEPDGVKLKIQEFKGGYHQLVITGVTGEDATV
YQVRATNQGGAISTTVSLDVEVPAEIHLPKHLEGMGAVHALRGEVISIKIPFSGKPDPVI
TWQKGQDLIDTNGHFQVIVTRSFTSLVFPNGVDRKDAGFYIVCAKNRFGIDQQTVELDVA
DVPDSPRGIQVSDISRDSVALTWNAPASDGGSKVINYVIQKCATTAEMWIRVGQSRDTHY
TVVNLFGKTSYQFRVIAENKFGQSQPSESTEPVVTKEDKTRVINYDDEVDELREITKQKA
THSATKELHTKYMIAEELGRGQFGIVHRCIKHSSKKTYMAKFVKVKGADQVLVKKEINVF
NVARHRSILQLHESFDSLEELVMIFEFISGVDIFERICSTTFELTEREIINYTRQICEGL
EFLHSQNIGHFDIKAENVIYTTRKSSNIKIIEFGQTRQLKPGDNIRIQFTTPEYTAPELH
QHDMVSTSVDMWSVGTLVYILLCGLNPFMAETNQQVIDNICNAEYNFEDEAFKEVSTEAL
DFVDRLLVKDRKARMTAADALEHPWLKQRTERMSTKVIKTLRHRRYYQSIMKKDLNVVVS
SARISSGGAIRSQRGVTVAKVKVAPIDIGPLTSQIMHATAEEGGHVKYSCRIENYDESTQ
VTWYFGIRQLESSSKYEISYQDGLASMYVKDINGADDGTYRCKVQNDYGEDSSYAELFVS
GVREMRSYYVRRKVRKAKRRVDTMRLLEKPPEFTLPLYNHSAYIGETVRFGVTITVHPEP
RVTWLKFGQKIKPGEDEKKYTFITDKGLYQLLIHNVTLDDDAEYTVLARNKYGEDSCKGR
LTITPHPPPADNTLRPMFKRLLANLECVEGNSVRFECRVSGTPPPTLKWEKDGQPLPFCP
NIEVIHEGLDYYVLCIRDTLAEDSGVYRVIATNSAGSTSCQAYLKVERVTYVKHQYRNEE
DRKQQVQKKIDKTLRMAEILAKVEHVSLTSVAQEALREAAILYKPAVSTKNVQGEYEISK
EEKVKAEKKLRMPYDIPQPRVHEARAIEEDQDIKQFVPLSDMKWYRKIRDQYEMPGPIEK
LVTKRPKRIRLSRWEQFYEVPLPRFTDQYKPKWRIPTSSQDDLEIVRPARRRSLSSECEI
CCRPRRRSLGDVSVDELLLPVDDYLSMKRVEEERLRLEEELVLGFSASPPRYSPQRFELS
SLQHKSLRTQLATEEEEEDYRKYKTYHIPSKHEAGTSFIDLRQRHDKAVYKPPKQKQRLI
DDREDEELLRPYRMTERLTSYKKELEHMEHEEKHRFTSRREVGIVQAQVGEEEEVMEVKK
YVRRESPSVSKFLRRRRSLSPTYMELMRPVSELIRSRPRRPAERLDSESEGSERRSPTPE
RTRPRSPSPVSRESSLSRFERTARFDIFSRYESMKSALKTQKTTERKYEVVTQQPFSLDH
GPRITLRMRSHRVPVGQTTRFTLNILSKPRSEVKWYHNGKEIQEGEKYKFTDMSGVLTLE
IVNCQADDSGTYRAVCSNYKGEASDYATLDVTGGGYSSYVSRRRDEEPPKPFMPDMTRTD
IYHLSTIKQATTTESSSELRGFKSEESQRREAVSSEGYAFEEKKLRTEEIRARTEESKTS
EERSTRTSTKLTVQARILTKPQSATVAEGESVRFVCDFDGEPAPTVTWKHAGTTISSSRR
HLITSTQFKSTFAISSVQSSDEGSYTVVVENAAGRQEAQFTVTIRKAVAKGMGVVSPPRI
KSPEPHGKPSSASKSAKRVKSPDQASSGSRVKSPPPVRTASAERVEIPASTPPKISQGLK
AEIHEDGAVKLTCTVESTVLNVKELTWLKDGRKIRENSHYKFEYSADGVYNLTIHGLNES
DEGEYTCEITGEGGVSKTAFSFVGQAFKSAVSKVAKITESKAAVQKKEVISKPIITMYLS
DLSVASDTMARLTVKLAGEPKPTVTWTKDGLTLAQSSKYKIFEEHGSFCLEVLHTETSDC
GVYGCTARNSAGSASTSCKVTVKASKSSTDSLRVESQRKSSIKAHETAVVEEQIVKQALT
LEEVKTSYTEIKASKMHMNAENGQKVILKASIPQAANVKWILNGTELRNSEDYRYGVSGS
DHTLTIKTVSFADEGIITCEAKTEHGVVKCQFDLIVKHSQSNAPSFVAQPKSQNVNEGQN
VSFNCEVSGDPSPEVEWLKDNHAIAITRNMKVSRSKSKYTLEILNTTVSDSGKYTVTAKN
FHGQCSATASLNVLALIEEPAKMVVLETSASASMQERFSSKTVQMSKQEASSSMSEVKFA
SMSSSSMSSMKESMLSMSSSSFMGHASMSQLEATAGKMITGCIKGSSPKIEALPSDITVE
KGKVLTVACAFSGEPTPDVNWTCGGRSLSSEGVGGRFHLETLDDLTTLIITGVKESDAGH
YTLKLTNEFGSDSATVNIEVRSI
NT seq 82152 nt NT seq  +upstreamnt  +downstreamnt
atggcattatcaggaaattcgaccacttttgaaggctgtgtaagaggtgcatctcctctg
tttgttacctggatgaaagacaaggatgaactccgagaagatgataatattaaaatttct
tttgagaacaacattgcaatacttcacattgctgctgttgaacacagtcacagtggaaag
tacacatgccaggccaacaatgatgcaggcattgagaagtgttttgccaccttgttagtt
gcagaacccgcacaaatcctagagaaaacagaaccactaaatgttacttcaggaaccaca
gcgattttggaatgtgttgtagctggcacaccagaactcaaagtaaaatggttcaagaat
ggacatgaggtgacatccagcagaaaatataaaatcagctgtgtgaataaagtggccagc
cttaaggttctgtctgttgataaggatgacagtggcgagtatacattcgaggtcaagaat
gagtttggacaagacagctataaaacgtctctgacagtgctagatcgaatgattgctcca
tcatgtacaagaaagttaaagaaaatggataacatattaggggctttcatgcacatggaa
tgcaaagtgtctggttctcatccaatcaacattacttggtgtaaagatgacaaagagata
atggcaaatgacaaatacaaaatatcttttgaagacaacacagcagttttggagatcgat
caacttgaaatcacggatggtggaaattactattgcaaagcaacaaatgatgctggaagt
tgtgattgcagtggattcttatccgtcaaagagccaccaagctttgtagaaaaaatagta
tcccaaggtagcataattggatccacggtgcaatttaagagtgtcgtggcaggaactctt
ccactgacagtgaaatggttcaaaggaagtcgggaactgaagcctggtacagcatgttcc
atttggaatgaaggctcaacacacttcatggaactaatttcaactaaaacgacggatgca
ggtggttatacctgcaaagtcagcaatgacgttggtgcagaaacctgtaatgcagaacta
ctcataaaagaacctccgacttttactcagaagccagctcctaccgctgtgttaaaaagg
ggagagtttggacgttttgagtgcaaaatagccggtacaccgcaaatcacagttacttgg
tatctaaataaccatgaaattagagccagtgagaaatacaggatatcatttgtaaactca
ttggcactgctcgaaattgctgggataagcattgaagacagtggcgattattcctgcgaa
gcacagaacgaagctggtagcaacggttgcaactttgtggtacaagttaaagaaccaccc
gtatttacaaagaagcttgaatctgtagaagtagtgaaaacaagcgatgtgcctcttgaa
tgtgaggtgactggtacaggtccctttgacgttgcatggtataaggacagtaagcacatt
cgacctggtaaaaagtaccagatgacttctgatgattcattagccagtctttgcattcta
aagtctgacttctcagatgctggtgaataccaatgtacagtaaagaatgatgtgggcagt
tgttcctgtagtgctggagtcagtttgaaagaacccccaggatttacacagaagtttgag
aatatgacagtgtttgctgggaaatccaccgtatttcaatgcctggtaaaaggctcaaaa
cctctttatgtaacttggatgaaagataaggatgatgtgaaagaggatggtgatatagcc
atgtcatttgagaacaatattgccaccctgcaaataaccggcactggagaaaaacatgca
gggaaatatatatgtcaggccaagaatgatgctggaactgagaagtgttctgccacatta
ttggtagcagaaccagcaaaaattacagagcaagcacattcgcttagcgtgactgtgggt
gatccagcgaatctggaatgtactgtcactggtacaccagaaataaaagtaaaatgcatt
aaggatggaaaggagctggtgtctggcaggaaatacacaatcagcttccagaataatgtg
gccagcctaaagtttccatctgtttgtcaggaggatagtggtgattatacatttgaggtc
aagaataagtttgcgtcctgcagttgcaaagcttcactgacagtcctagatcaaatagtt
cctccagaatttaccagaaaattacggaaaatggacagtgttttaggatcttttatactc
atggaatgcaaagtttctggttctcttccaatcagtttttcatggtataaggatgacaca
ataatatctgctagtaaaagatgcaaactgtcgagccatcacaacacagcggttttggag
attaatgaactagagatggcagatggtggagtttatgcttgtaaggcaaccaattcagcg
ggaagtgacgattgcagcaatacctttattgtaaaagaaccaccaagttttatcgaaaga
cctgttgcccaggaggttatacctggctcttcagtgcagtttaaaagtgttgcacgagga
acttctccgctgtctatcaaatggctgaaggatggcagggaattgatgtctggagctgaa
tgcttcattttaattgaaggctcatcgagtttgctagagctattttcagccaaaatttcc
gataccggtgaatatacttgcgaagccagcaacagcgttggcagtgaaacttgtacgacg
aggctctttgtcaaagaacctccatattttattaagaagttagacctaacagcagtgtta
aaaacaggagaaacagcacgctttgagtgcaaattaactggcacacccgaaatcagtgtg
acttggtacagaaataactgtgcaattagtggcagtggaaaacacagaatatcatttgtt
gattctgtggcaatctttgaaattactgatgtcagtctggatgatggtgggaagtattct
tgtggagcccagaacgaagctggtagtgaatcttgcagcattgaagttaaagttcaagaa
cctccgtcctttagtcagaagctggaacctaccaaagtgctgaagaagggtgaatcggca
cattttgagtgcagagtgactggcacgcctgaaatcaaggtctcgtggttcaagaacgac
agcgaaattagagcgagtaacaaatataaaatgtcctttgataaatctgcggccgttctt
gagattgctgagtctgacgtgccagatagcggggattacatctgtgaagcacacaatgaa
gcaggcagcgtgagctgcagtgttgccgtcacagtcaaagaaccccctgccttcagtaaa
accctggagtccgtgcacgtactgaaaggctctgatatcattctccagagcgagctgact
ggcacagctcctttcgagatcacctggcacaaagacaaacggcaaatccgagccagtaaa
aaatacaagatgacttacgagaactatgtagcgtgccttcatattcttaaagtggaaacc
tcagatgtaggcgaataccagtgcatgtctaagaatgacgtggggagtgacagttgtact
ggcacgttaaagctcagagagccaccttcgtttgtgaagaaactctcaaacgcttctccc
gtccttggggagtcagtcacgttgcaggctatcattaaaggttcagagcccattcacgtc
acctggttgaaggagaaggaggaagtgcgagatcatgagcacgtgacaacatccttcgaa
caaaatgtcgtcaccttgcacatcgcaaaagcagaaagcgtccatgctgcaaattacact
tgtcagatcaaaaatgatgctggaatgcaagagtccactgctaaagtatcagtcctagag
ccagccacgatagtggagaaagcagagtctgtcagtgtgactgcaggagacaccacagct
ctggaatgtgttgtggctgggacaccagaactgaaagttaaatggttcaaagatggtaaa
gaactagtgactggcagaaaatataagatcagttttctgaacaagatcgccagcctaaag
cttctttctggagaaagggaagattcgggacaatatacttttgaagtccagaataatgtt
ggtagagatagctgcaaagcaacaatcaatgttctagatcgcattattccaccatcattc
accagaaagttaaagaaagcagatggtatcctggcctctcccatcctaatggagtgtaag
ttgtctggatcagcgcccttcaccatcgcgtggctcaaagatggacaggagattgtacat
gaagaaagatatgatgtctcgtttgcagataacacatgtaacttaagaatcagcacactg
gaaactttggatgctggcaattatacctgtaaagcaacaaatgctgcaggaaatgatgaa
tgcagtgctgtcttgactgtgaaagaaccaccttcatttatgagcaaacctgaatcccaa
gaggttttgcctgactctacagcaagatttacgtctgttgttactggaacggccccactg
aaggtgaagtggtttaaaggtagcactgaactggtaactggaagaaaatgtcatatttcg
ttgactgactcggtggcagtattggaactacttaatgtcaatccatctgaaagtggagac
tatatctgtcaggtcagcaacgatgctggcaaggattcctgcacagcaaatctatttgtg
aaagagccagcagtgttccagaagaaattaaaggattccagcattgaactgaacaagtct
gtctgtctggactgcacctattctggaagcccagaaatcaaggttatctggaagaaaaat
gggtttgaattatttcaatctgaaaaatataccctaactaccacagataagtcttgtata
ttagaaattcagcacagcgttagagaggatggcgggaaatacacttgtgaggtggaaaat
gctgccggaggggacatttgtcacgctgaagtgactgtattagaaccaccaacttttgtc
catgaattggtgcctttggaagtcacactcggtgatgcaatatctctgtcgtgtgtcctt
actggaacccctgaaattaaagtgtcttggtacaaaggagacactaagctgagaatgatg
tctaacattgggatggcatttcacaacaatattgccacactggaactgaagaaaacagct
ataagtgacagtggggaatatgtctgcaaagctgaaaatctaattggcagctgttcctca
aaggccacgctgactgtacaagaacttaaaactgcaccttctttcacaagaaaattgaag
gacatggaggaaactatgggtcgtccagtaacatttgaatgccgcttgtcaggttcagct
ccaattgaaacggcttggtttaaagatggagtgaatttgtccagtggaggaaatgtaaca
atatctttcatagaaaacctggcaactcttcagattcttaacgctgaaatggtcgatgcc
ggggaatatacttgcaaagcttccaacatggttggagaagcctcatgtggttcaaaacta
actatgaaagaggccagagctgctcctgagtttgataaaacgcttgaagcagtggaagtc
acagctggggacccagtagagcttgaatgccatgtaactggctctacccctatcaaagtg
acctggttgaaggataaccgagagattcgatctgggggcatctataagatgacctttgag
aacaatacacctcacttgacgattctaaaagcagagaagggagaggcttgccaatacact
tgtcaggccagcaatgatgtcggaaaagtctcttgctcagcaggagtgactgcaaaagaa
cgtaaaatcccaccaagcttcacgaaaaagcctcttgaaaccatacaagatacagaaggc
aaggctgtaaaactggaagctcgtatatctggttctcaacctctgtctgtaacatggttc
aaggatgaacaggaaatacatcaaactgaacatgaaatatcatttaagaataatgtggtg
ctgttgaacatgaagaaagcacttcccatcgattcggctgtttatacatgcaaagcttcc
aatgaagtgggatttgcatcatttaccgtgtccgtgctcatcaaagagcttaaaacgcca
cctgtctttgatataccacttaaaccactgacagcaactgaaggagagtcgccgcagctt
agctgccacgtccacggaggtgaacccattaagatccagtggcttaaagacagaagagaa
ataaaaacatctgacaaattgaagatgaccttcaccgatggcacagctgccctggaaatc
aaaacagtggttaaaacagacagtggggactatctatgcaaagccacaaacgaggttgga
agtgactcttgcaaagccaagttaacaattcaaggaaaaaccaccccagcaaagaaagtg
gccactccaccagagccaggcaagatcttcttcattgagaaaccaaagaacacaaaagta
acggaaaagagcacagcagcatttatagcaaaagttggtggtgacccaataccaaatgtt
aagtggatgaaaggcaaatggaggcaactgaaccatggtggaaggttttttgtgcaacaa
aagggacaagatgccaaactggaaatcaaagatgtggtaaaatctgattctggagagtat
aggtgcgtcgcatcgaacaattttggtgaacttgaatgcagcgcgagtatggaggttgcg
gagaagaaagaagtcttcattgaaggagatctcagagcaaagctgaagaaaacaccttcc
aagcaaaaggaagaggaaccagataaggagattgatattgtagaactgctgagaaatgta
gatccaaaggaatatgagaaatacgcccgtatgcacggaatcactgatttccgtggactt
cttcaagctatggaacaactgaaaatgagtaaagaagatgagagtcacagggttgagatc
gaagagcatgagcgacctgcacaagaggaatttgatgaactcatccattatattcagcaa
aaaatacagaatgttgagcccgttgaattgatcaaggatattgaagatcaaacggtacgc
acaaaagtggatgccttgtttgaatgcatcataaagataaattacccggaaatcaagctg
tcctggtataaagggaccgaaaagttggaatcaaatgacaagtatgagattaccattgat
ggtgacattcatcgcttgaaagtcaaaagctgtgaattccacgatcaaagcaatatccgc
cttgtctgtggcccacacatctcaagtgctaagctaaccgtcgttgaacccattgtggaa
caacatcttgaacacctttccggcaaggaaggacagatctgtatcatggtctgccagttc
tctctgcccaacctgaaaaccgaatggtttaaaaacggtcggcagatcgagggacgaggc
agatattcaatccacgtttcagataagacacaaaaactgacgatcagtgatgtgaaaccc
gaagatcagggtagatttacgtgcaagtttgaaaaccttgagacgtctgctgacctgagg
gtggaagctgaaccaatcgagttcacgaaggcgatccaggatatcgtagtgaacgagcat
gagtcggctacgtttgaatgtgaggtgtcttttgatgatgcaatagtaacctggtacaaa
gacacaatggaactgcaagagagtccaaaatacagcttcagaagaactgggcgacgccat
tttatgactatccacaatgttgctgctgaagatgaaggtgtctattcagtaattgctcaa
cttgagccaagaggtgaggctaaaagtactgcagagctctatgtatcgagcaaagatgtc
gtcttgcagccaatggaacctgatgttcctgatattggaatttcagttgaaacagtacaa
gtagaacaaaaacacataaaagaagaagttacaacatatcacgaagagatttatgaagag
acacatgaagagattttctatgaaacaatacacgaagaggagatcacagaaatcaaagct
cccaagaagcctgtatctaaaacgactccagaggctattgttgaagaagagatttctgcg
accagagtgtctaaagttacaaggaggactggaagactacctgaacaaattcctgcacct
aggattcctattacagaggagatcacggcacaaagagtatcagagttgtatgagaaacaa
tccattgaagaacgtgtaagcatttcaacagaagaagagattgttgcaataaaagtccca
gaggttcctaagaaaccagtacccgaagaagtgaaaccagttccaagcaagaaagaagtt
gcaccagcaaaagtgccagagccatcaaagaaaccagagccatcgaagaaaccagagcct
gaaattattccaaagaaaaaagaagtcccaccaaaagtgccagaggttcctaagaagcca
gttgttgaagaacctaaacctgttaaagttacaagaaaagaggtggttgccccagtagaa
gtgcctgaggttcccaagaagccagttgttgaagaagttaaaccagtcactgttgaaaga
aaagagactcctgcagcaaaagtgccggaggttcctaagaagccagtccctgaagaggtt
aagcctgctcttgttcccaaaaaacaagtgatccctccagccaaagtgccagaggtgcct
aagaagccagtggctgaagaggttaaacctgttggcgttccaagaagagaagaggtcact
ccagtcaaagtgccagaggttcctaagaggccagtggctgaagaggtcaaacctactgct
gttccaaccaaagaagagattgtgccaactaaagtgccagaagttcccaagaagccagtt
cctgaaaaggtgaagccagttgctgttcaacgaaaagaagagatcgctccagctacagtg
cccgaggttcgtaagaagcctgtggctgaagaagtgaaaccagttactgtttcaaggaaa
gaggagcccgcaccagcaatagtgccggaggttcctaagaagcatgtggctgaagaagaa
ccagttattgttccaagaagaaagttgatctctccaactgaagtgccggaggttcctaag
aaaccggtggctgaagaagtcaaacctgttactgttcctggaaggaaggtgtctcctcct
gctgaagtgccggaagttcctaagaggcgagtaactgaagaagtgaagccggttattgta
ccaagaaggaaggagattcctccaaccgaagtaccagaggttcctatgaagccagtggct
gaagaagccaaaattgccactattcttagaaggaaggagtctcctccaactgaagtgctg
gaggttcttaagaagagagtagttgaagaagtgaaaccagttaccgttccaagaaggaag
gtgtctcctccctttgaagtgtcagaggttcctatgaaaccagtggctgaagaagtcaaa
cttaccactgttcttagaaggaaggagtctcctccaactgaagtgccggaggttcctaag
aagagagtagttgaagaagtgaaagctgttaccgttccaagaaggaaggtgtctcctccc
attgaagtgccagaggttcctatgaagccagtggctgaagaagtcaaacttgccactgtt
cttagaaggaaggagtctcctccaattgaagtgcctgaggttccaaagaagcgagtagtt
gaagaagtgaaaacagttactgttccacgaaggaaggaatctcctcctactgaagtgccg
gaggttcctaagaagcgagtagttgaagaagtgaaagcagttactgttccaagaaagaag
gtgtctcctccctttgaagtgccagaggctcctaagaagccagtggctgaagaagtcaaa
cctgccactattcttagaaggaaggagtctcctccaactgaagtgccggaggttcctaag
aagagagtagttgaagaagtgaaaacagttactgttccaagaaggaaggtgtctcctcct
attgaagtgccagaagttcctatgaagccagtggctgaagaagtcaaacttgccactgtt
cttagaaggaaggagtctcctccaattgaagtgccggaggttcctaagaagcgagtagtt
gaagaagtgaaaacagttactgttccacgaaggaaggtgtctcctcctactgaagtgcca
gaggttcctaagaagccagtggctgaagaagtcaaacttgccactgatcttagaaggaag
gagtctcctccaactgaagtgctggaggttcttaagaagagagttattgaagaagtgaaa
gctgttactgttccaagaaggaaggtgtctcctccgactgaagtcccagaggttcataag
aagccagtggctgaagaagtgaaaccagttactgttcccagaaggaaagaggctcctccc
actgaagtgccagaggttcccaagaagccagtagctgtagaagtgaaacctgctgctgtt
ccagaaaggaagaaatctccaactgaagttcctaagaaaccagtggctgaagaagtcaaa
cccatttccgttccaagaaggaaggagacccctccagctgaagtctttgaagtgcccgag
cctcctgagaagccagtggctgatgaagttaaacccgttgcagttcctagaaggaaggag
attcctccgactcaagtgccggaggttcctaagaagccagtggctgaagaagtcaaacct
gttactgttccaagaagaaaagagattcctcctgctgaagtgcgtgaggttcctaagaaa
ccagtggctgaagaagtgaaaccagttactgttcctagaaagaaggagattcctccgatt
gaagtgccagaggttcctaagaaaccagtggctgaagaagtcaaacctgttgctgttcca
agaagaaaagagattcctcctactgaagtgtcggaggttcctaagaaaccagtggctgaa
gaagtgaaacctgtcactgttccaagaagaaaggtgtctccaccaactgaagtgcccgag
gttcctaagaagccagtggctgaagaagtgaaaccagttactgttgcaagaaagaaggag
attcttccaactgaagtggccaaggtccctgtgaaagcagctgaagaagaacctaaacca
gttcctgcctcaagaaaggaggaggtcgctccagctaaagtgccccagatccgtaagaag
ccaattgttgaagaaaggaagtcaattactgttcaaagagaagaggaagtcgtcatagtt
gcagctgctcctaagaagccaattgttgaagaacctaaaccagtttatgtccaaagaaga
gaagaggtcactgaagtacaagtgatggagtttcatgaagagacttttgaagaagaatat
caagaaatcatcgttcaaagcagagaggaagttccttcagtgaaagtgccagtggtttct
aagaagatagttgctgaagaagagaaactagtcactctaacaagaaaaggcactgctgtg
aaagtgccagaggcccctaagaaaccagttcctgataaagctaaaccagttactgtcgcg
aagaaagaagctgaaccagccaaagtgccagaggcccctaagaaaccagttcctgataaa
gctaaaccagttactgtcgcgaagaaagaagctgaaccagccaaagtgccagaggttcct
aagaagcctgctcttgaagaagaaaaacctgtcattgttccaagaaaattggagattgct
ccaacaaaagtgccagaggtgcccaagaagccggttcccgaagaggtgaaaccagaagct
gtgccaacaaaagacaaagttgctccagccaaagtgccagcagttcccaagaaggaggtt
gctgaaaaagtgaaaccagctgttgttccaaagaaagagatcattattcccaagaaagat
gcagctaaagtgccagaggttccaaagaagcctgatgctgtacaacttaaacctgtgcca
agaaaagaagaagcaccgaaagtgcccaaagttgacaagaaggtacaacctgcacccatc
agcgtttcaagaaaagaagcaattatttcaaaaaaagtgccggaagatgtaaagaagcct
acatctgaaaaggtgacaccaatcactgttacaccaagaaaacaagttgtgcctctaaaa
gaccctgaggttacaaaacaacctgcttatgaagaagacagggaaacatatgaagttata
gaagcatatgaagaatataaggaagaatatgaggtaatagaaacatatgaagaacataag
gaagaatatgaagtaatagaaccatatgatgaagagaccgaagaacttgatgaagagata
gaagcgtttgaagaatatacagaagcctatgttgaagagcctgaagaagatgaagaagat
acagaagtatatgaagaaaaagaaatgaccattcgacctaaagtgcctgaagttaccgag
aaacccgtccctcaaaaagttccaatcaaagttccaggagctcccgagattgggaaaaaa
ccaacacccacaatcgcttctgaagaagaaccaaccaaagaagtacctggtgttacagct
cctataacgactccaataggaggcaagagacctgtaaaagctacagaaaaaacagaggca
cctttgaaattaaaaccagcagtcaaagttccaaaggaagtagtggaagatttgttagaa
atcacaaatctgaagaaaactagtaagatttctaaggaagaggaaggtgaacagcgcgtt
atacgcaggaagtttgatgcatcacccaaagaagaggaaaaacaattagaattaaaacat
aggatacgtgttaaaagccctaaggaagtggaacctgaccgggaagttttgtcattaaag
aaagatggaatattctcaaaggaggaagaagaaaatagacaatcaggactaaaggtagtt
agtgatgttcctaaaatagatgataaggtaaagggaacaacactcaagaaaccagataag
atcaccatggaagaagatattgtagacaaaccattgctgaaaaaatctggtagagttcct
gaagaagaagaaaaggaaccagaaagtgtaacacttaagaaacctagtagggtccccaaa
caagagagagagccagagaagggattagtgaggaagcctaaagaagaaaccgtgaaagaa
aaagagttagcagcaaaggtacctggtagagtccccaagggcatagaagaccgaggaaag
caaataatactcgaaagggatgacgaagttcctttagaaaaaggtgaaaaaactattaca
ccattgaccaaacctgaaagagttcccgtggaggtaggtgaaaaggaaaagccatcagtg
aaacaggttgaaattcctctaccagagaaagctaaacaaactgtcgttccaatgaaaaag
cctagcaaaagccctaaggagcaagaaaaagaagaaaaacatttggtgcagaaaaaagtt
catataattcccaaagctgaggaggagaaaaaggaacatccgagtctcaagaaagttgac
tttcccaaagttgttcaagatgaacccaggattaaaccgtctatcgaagaagaaaaacct
aaaggtatagacatccacccaatggataggatgcccagggagaccattttggaaaagact
gcagagaaacctattccaggacaggttccccctgaagaggccgatgtgcctcctaagcga
gtacctgagaagaaggtggtggctcccaaagagacgcctcctgagtctcggtttaaaatt
ggtaaagggaaagtgccaatatcagaggaggacaaagaaatcgttgagttaaaaccaatt
ccctcaaaaagaagggcatcggaagaaaaagaaccccagaaacctcctaaagtgcccgaa
aagcaaataattatgccaaaggaaatcattacgtcaaaggaaaaaccaatcgcatcacgc
tctccaataggtaagggcaaagtgcctgtttcacaagaacagaaagaacccgtgcaactt
gaaaaagttccctcagaagaaactccatttgaggaaaaggaaccacagaaaatagcggac
aaggtggcagtatttgatgagaagcctggtgagaagcagcttctgattggcaaagggaaa
gtgccagtttcagaaatagggaaggttgctgtagaactgaaaaaagttccctcaaacgag
gttgcgttggatgaaaaagaaccaaggaaagtacctggaaggaaagtcatatcccctaaa
gtatctccgaaagagaaaacagattctgtggacagtacaattagcaaagggaaagtgccc
atatcagaaatatcagaaataccaaaggaaactgttgaggtgaagaaagttccttcaaag
gaagttgtggctgatgaaaaagaaccaaagaagataccgggaaggaaagcaattttcccc
aaagagaaaccagatgacgtagacattagaattagcaaagggaaagtgcccctatcagaa
acaccaaaggaaactgtagagataaagaaagttccctcaaaggaaattgtggcagatgaa
aaagaacaaatgaaaatacctggaaggaaagttatttcccctaaagtattccctaaagag
aaaccagatgctgtggacagtgcaattagcaaagggaaagtgcccatatcagaaacacca
aagggaactgtagagatgaagaaagttccttcaaaggaagttgtggctgatgaaaaagaa
ccaaagaagatatctggaaagaaagtgatttctcctaaacagaaacctgaggctgtagat
cgtaaaattaggaaagaaaaagtgcctatttcagtcaaagaaagcgaaacagtagagctg
gacaaggtcccttcggaagatatttcacagggagaatctgaagcaacacatgaagcagct
gatgaagaagcttatgaaggcgagattgaagagccagaagaagggacggaggagatatca
tcagaagaattaccatacacagaagattgggaatgggaaggaactgaaggagaggaagaa
tatggctcatctgttgattgggaatgtgaagatgatgaagaattagttgagggtgtagtt
cagactcctggaaagtcttccaagcaacgagatgctaaggcaccaggtgaagaagctggc
aggggcagaggttcaccaagagcgagaaaaacgccatcgcctggagacgcagacaagaaa
ggacttaaaccaggtggtggcagaccgcccggagaagaggcaccttttgcagggttccag
cttaaagcagtcccactgaaatttgtcaaagagctaaaagatatcgtgttggaggaggcc
gagtccataggttcttctgctgtatttgaatgccagatctcgccatcgacagcacagaca
tcctggatgaaggacggaagcactgtgagagagagccctaagcacaaatttacatccgat
ggcaaagataggaagctgcatatcattgatgtgcagctttcagataccggtgaatatacc
tgtgtaggccgtctcggaaagcaagaaaagatgagcacagccaaactaatcgtccaagaa
ctgccagtgcaattctttaagacgctggaagaagagatcatggtcttcaaaggacaacct
ctgtatctgacctgtgagttaaacaaggacagagacgtgatttggaagaaggatggtgaa
gttgttgaaaatattcctggcaaattaactatcagtgtcatcgggctgcagcgctccatt
actatctcagacagtgacttttctgatgctggagtgtatactgtcgagactgctaatata
aaatgtgaaggaaaagttagcgtacaagaaattgtcaggaaatggtttgtcaagccactt
cgggaccaacgggtcaaacaaaaggaaactgccgtctttcaatgcgaaatcgcaaaggat
acaccaaatatcaaatggttcaaaggcgaagaggagatttcagcaatgcccccgtcaaag
tttgaaattaagaaagttggtaaaattcttactctcacactgaagaatgtgagccccgag
gaccagggcgaatacacagtggaggtggaaggacaagcctccacagccaacctgatcgtt
gacgagcgtgagatcgacatacttttagaactgcaaagtgtggaagtttacgagaaagaa
accgctgtctttgaaactgagatctcgcaagatgtttcagtagagtggaaacttaaggga
gaaatactgcgcccatctcctacctgtgaaatgaaagatgaagggactaaacgtaccttg
acccttcacaatgtcagactggatcaagctggtgaagttatcttcagggcacggaatgcc
acatccattgcttacctgagagtgaaagaaattgaacttgactttgaggtacccctgagt
gacgtgactgtgcctgaaaaacgtcaagcacggtttgaatgcgtcctcaccagagtggtt
acgaagattatgtggactaaaggctcagatatacttaaggttggcgataagtatgatttg
gtcgctgatggaaagaagcagattcttgtcatcaataactctacttttgatgatgaagga
gagtattctgctgaagtcgacgccaagaaaacaactgcaaagctgattgtcactggtaca
aggttgaaattccttacaccactgaaggaccagacagttaaagaaggaaacacggctcat
tttgaaattgagctttcccacgaaaatttgcctgtgacttggtacagaaatgaaaccgta
cttcatccaagcagaactgttctgatctccactgacgagaagaagcatgttttagaaatt
agagaagtgactctggatgatacatgtgagatcaaggcagaagtcactgaactttccacc
aaaggttgcctgattgtcatcgaggcagatccgtatttcacggtgaagctacaggattac
actgccgtggagagagatgaagtgaaactggaatgtgagctcagcaaggatgtgccggtg
aaatggcggaaggatggtgaagaaattagagcatcaaaaatagtctctatgaaggctgaa
gggctacgccgaatattgataatcaagaaggttgacaataaagcgaagggtgaatatgaa
tgtgactgtgggactgatgtcacaaaagcctctatgaatattgaagcacgcattatcaaa
ataatgcgtccactatttggagtagagatcttcgaggatgaaactgcacgttttgaggtg
gacatctcagagactgatgtgcatcctcagtggaaactgaatggagaaactctgttacca
tcacccaattgtgagattctcgaggatggtaagaagcacactttgatcctgtacaactgc
aaactgaaagactctggagaagtcgcttttcaggctgctaatgctaagtgtgcagctaac
ttgaaagtcaaagaaatcccaatcaccttcattacaccgcttgatgatgtgaaagtgtac
gagaaggacgaagcaaagtttgaatgtgaagtatccaggaagcccaagacattccgttgg
ctaaaaggaacagaggaggttaagtcagatgctaagtttgaggtcttagaagaaggaacg
aaatatgcattggtaattaaagaagctgcatttgatgatgaagcaaagtatacgtttgaa
gcagaggacaagaagacaagtggaaaactgattatccaaggtatccgacttgaattcagc
aaacccatcgaagaccaaaccgtgaaagagcgtgagacggcagaatttgtagccgagctt
tctcacgagaatattcaggttgtgtggtacaaaaatgacgtacggctgcacccgagtcga
gtagtaaccatgaaagatgacggtaagattcacgccattatgttcaaagacgtgaccatc
gatgatacctccctcatcaaagctgaagctatggaccaaagttcagaggcgaaactcatc
gtccttgagggggatccttactttatcagcaagttgcaggactacacagcggtagagaaa
gatgaagttgtgttccagtgtgagatcagtaaagcgggagcaccagttaaatggttgaag
gatgggaaagaattgactccttcaaagaacattcaatttaagaccgacggcaagaagcgc
ttcttaatcatcaaacgagcactaaagaccgaccagggagagtattcatgtgactgcggt
tctgataagacaaccgccaagctgaacaccgaagagcgtgacataaagataatgcggcca
ctgtacagtgttgagatcacagaaaccgaaactgctcgctttgaggtggaaatctccgaa
gaagatgtacacggcaactggaagctgaagggagaaagtttaagaccgtcacctgactgt
gagattaaggaggaaggcactaagcatattcttattctgtacaatgtaccactgggtcaa
gccggtcaagttgatttccaagctgcaaatgccaaatccaacgctcatttgagagtcaaa
gcacgagtcatcggcttgctccggcccctgaaagatgtcactgttgttgctgggcattct
gctaccttcgagtgtgagctctcgtatgaaggaatcccagttgagtggtttttgaaggac
actaagttggaagccagcgacagggttgttactcgcgctgaaggtagagtgcacactttc
accctcagagacgttcagttagatgaagcaggaaaagtcaaaattactgccaaggacttc
actacatctgctaaacttattgtaaaagaacctgcagcagaatttactaaacctctggag
gaccaaactgtggaagaagaggccactgctgttctggagtgtgaagtgtctagagaaaat
gctgaagtgaaatggtttaaggctggacaggaaatctttaagtccaagcaatacgatatt
gttgcagaaggaagaattagaagacttattatccatggctgcaaacctgataattctaag
acgtatacttgtgatgcaaaagactttaagacatcctgtttcctcagtgtggaagctcca
catatcgagtttacaaagcctctcactgaccttgaagtgaaagaaaaggacgtggctaaa
tttgcgtgtgaagtttcacgggaagatgcaaaggttcgctggtttaaagatggcatggaa
ataaggaaaggcaaaaagtatgatatcacagcgaagggtgtcgagagattgttgaccatc
cacaagtgtagctttgatgatgaagctgaatatgaatgtgatgcaaggacctctaaaaca
tctggaatgcttacggtgttagaagaggaagctggcttcaccaagaagctcgcagatgtc
gaagcttctgaaacggacactgtcaggctggtgtgtgaagtctccaagccggatgccgag
gtcacgtggtacaagggagacgtggagctgcctgacattggcagatacgaacaactcaca
gatggcaagaaacgcattctagtcattcacaacgtcaatccagaagacgttggtgaatat
aactgccggctcccaaaagggatccgcacttcagctaagatggcagttaacgaactggca
gcagaatttacttctcggccaaagaaccaggaggtgctagaaggagacaaagcagagttt
gtctgcgcagtatctaaggagtcctacgaagtgagatggttcagaaatgatacagagctt
gggactggggataagtacgacattatatcagagggcaataagcgagtgcttgttattaag
gactccatattggatgatgaaggaacctatgcagcaatggttgcctcctcacgagcaaca
gcagatctgacagtgattgaaaaactaaggataataactcccatcaaagaccagcttgcc
aaagaaggacaagaaactgtattcaactgtgaagtcaatgttgaaggtgccagagcgaaa
tggttgaaaaatgacgaggttattttcgatagtgcaaaatatttcttgctccagaaagat
ttggtctatactctcagagttaaggattcccaaatgaaggaccaaggaacgtacacaatt
gccttgacaaataatagaggagaacatgcagcatgctcagccgaactggaagtaaaagag
gaggagctgaagatcatcgagcctcttgatgattgtgaaacaatggagaagaagtctgcc
atcttctcttgcaaagtgaaccgtgaaaatgtcactctagcgtggatgaagggtgggcag
gagattacatttgaccgacgagtttcatataaaatcgataagaaaaaacactccattcta
atcaaagagtgtagctttggagacgaaggtgaatacactgtaacagcaggacaggacaaa
tctgttggtgaattgattatcacagaagcgcccacagacttcaccgagcatctccaggat
cagactgtaattgagtttgaagacgctgtgttttcatgtcagctgtcgaaagaaaagcct
gcagtgaaatggtacaggaatggccgcgagctcagggagaacaaaaagtaccagtttgag
aaggacggtagtttgcacacacttactgtaagggaatgcagacccgatgatgaatgtgaa
tactcctgtggtgtcgaagatagacgttccagggcgaggctgttcgttgaagaaatccca
gttgagatcatcaggcctccacaaaatatcttcgaagctccagattccgatgtgatcttc
gaagctgaattaaacaaggatagggtggaagtcaaatggctccgaaacaatatgatcatt
gtccagggtgacaaacatcaaatgatgagtgaagggaaggtgcacagattgcagatctgt
aacatcaaaccgcgtgatcagggcgaatacaggttcattgccaaggataaagatgccaga
gcaaaattagaactagcagcggtgcctaccatcaagataactgatctgaaccttgtgatt
gatgctggaaaacccttcacaatgacacttccttatgatgcctatccacgtggtgaagcc
aaatggttcaaggaagatagtaccacctcagagtatgtgagcctgcccaaacagaacatc
gacacaaccgtagacatgacaagttatagactttcagatccaaagagaactgacaaagga
aggtacaaggttatcattgcaaacaaacatggaaagggagaagcatacatcaatttgaat
gtcattgatgtgcctggcccaatccagaatttgaacatcgtagaaacttatgatggtgaa
gtgagtcttgcctgggatgagcctgacagtgacggtggcagcaagatccttggatacgtc
gtagaaagacgtgatgtaaaacggaagacttggaccttggctactgatcgtgctgacagc
actgagttcacagtgaccgggctccaaaaagtcttagagtacctgttccgtgtgagcgca
aggaacagagtaggtacaggtgaacctgtggaaactgatgtacctgttctagctaagaat
aagtttgatgtacccgatgcaccaatcaatgttgacgtaaaggatgtgaataaattcggt
gccaccattacgtgggaaccacccgagtacgatggtggagcagaaatcaccaactacata
attgagttacgagacagaacgtcagttaaatgggacgtagcgatggttaccagtgcagat
gagctctcggctcagttgaatgatgttgtggagaacagagaatacatattccgtatcaga
gcagagaacaaggctggcattggaaagccaagtgcagctacacatcctgtcaagattatg
gatccaatattcaaaccaagcccacccatcaatctcaaatgctcagatcagaccaaagat
tcggtacagctgaactgggaggctcccctgaaagatggaggaagcccaatactgggttat
attattgaacgacaagaagaagacacggataaatggattcgttgtactctcagacttgtt
cccgaaacaacattcaaagtccctggactgaagcaaggagtcaagtattattacagggtt
tcggctgaaaatgcagcgggtgtgtcagatccagctgatgctctcgggccactgacagct
gatgatcctcacgtggctccttccattgatttaagagatttcaaagacggtctcgaggtc
attgtcccagagccacttaagatccgcgttcctatttctggctacccaacgccaactgca
acctgggccgttgatgacaaacctcttgaaagtggcgatcgtgtgaaaatggagacaacc
gcgagatacacacaactgatcgtttgtcccagtgaacttcctgacaagggcgtctacagt
ctgacgcttgaaaatcctgtgttatccatttcaggggacatcaaagtgaatgtaatcgcc
cgtccgagcgcacccatggatatcaaagtggtggaaatcggtaggagttcagttcaccta
acctgggagccaccagaacacgatggtgatagtccattgaccggctacctcattgagaaa
cgagaagttaatcgcaaaacctgggtcaaagttatcgagggtgtggttgacctggagtat
acagttcctgacctgtatcagggaagagattacctgtttaaaatttcagcctgcaacaag
tgtggaccaggagagcccggatatattgatgaacccgttaatgtatctgcaccagcaact
gtcccagacccacccgaaaatctcaagtggagggatccatctgccagtggaatcttcctc
acatgggaaccgcccaaatatgatggaggttcacgcattaaagggtatatggtagaaaag
tgccagcgtggttctgaaaagtgggagatgtgtggcgagccagtatttgacctgaggttt
gaagtgactggcctgactgaagggcagtggtattcataccgcgttaaagcattgaacaga
caaggtgccagcaggccaggcaaacctacagatgatatacacgctgtggatccaaaagag
cctccagagatccaacttgatgttaagttgctcgctggcattactgtgaaggccggaaca
aaggttgagctgccagcctgtgtgattggcaaacctgagcccagagttacttggacaaaa
gctgaacgtttactgagggtcgacaccagaataaccatcgagacaaaacctggtcattcc
accgtgacaatcatggataccactaggagcgacactgccacctacattattgaagccgta
aacaccagtggccgggctacagctgttgttgaagtcaatattctagataaacctgggcct
cctgcggcatttgacatcactgagattacgaatgaaaactgtgtcttgacttggaatccc
ccgagagacgatggtgggtcacgtgtcacaaattacattgtgcatttcaaagaaggagct
agcgaagtatggaagaaactctcaaccaccatcaaagacaccaaatataaggcgatgaat
cttacacccttcaaagaatatgttttcaaagtttgtgctgagaacatgtatggcattgga
gagccatctgagcacgctccaattgtagccagatattctttcgatccacctggtgctcca
acacatgtccagccttcagatatcaacaaagattcattgactttgtcttggaatgaacca
gatgaagatggtggtagcccaatcactggatactggattgaaaaattcgatccagaaact
gacaaatggatgagatgtaacaaaataccaatcagagatactaccttcagagtgaaaggg
cttgcaacaaagaagaagtacaagttccgtgttctagcagagaatctcgctggccctggc
agtcctagcaaagaaacagaaccgatcctagtaaagaatcccattgatccaccttggcct
cctggaaaacctagtgtcaaagatgtcatgaagacgacagtattcctaatgtggaccaaa
ccagaacacgatggaggagcaaagattgagtcttatattatcgagttgttgaagaatgga
acagaagactgggtcagagtagctgagggtgttcccatgactgaatatttcctgaaaggt
cttatggacaaacaagaatactcattccgcattagagctgtcaacaaagctggtgaaagc
gagcccagtgaacccagcgatcccgtcttgtgcaaggagagactgaatcctccctcacct
cctcgttggctggaagtcgttaatatcacaaagaataccgcagaccttaaatggactccg
ccagagagagatggtggctctccggtcacaaattatattatggagaagagagatgtgaga
cgaaagggttggcagactgttgacactacagtgaaagacattaaatatacagtgacacct
ctttctgagggttcgctctatgtcttccgtgttgctgcagaaaatgtagctggacagagc
gattactgtgaactggaagactcggtactggctaaagacacgttcactactcctggtcca
ccctacgcacttacagtgttggatgtaaccaagagacacgttgaattgaaatgggaggct
cctaaaaatgatggtggaaggccaattcagaggtacgtcattgaaaagaaagagaaatta
ggaactcgctgggttaaagctggtaagacggcaggaccagaatgtaactatagagtcact
gatgtaattgaggggactgaagtacaatttcaagtccgcgctgaaaatgaagcaggatgt
ggacatccaagtgaacctacagacatgctcttaattgaagatccaacaagtcctccatct
cctcctcttgagctacatgtgacagacgcaagcagaggccatatttctattgcctggaag
gcaccagagaaaaatggtggcagcccaattcttggctaccatattgaaatttgtgagcca
ggaaccgaaaagtggatgaggattaactctcggccagtgaaggacctgaaatataaagcg
gacgaaggcatcaaacctgataaggaatacatcctgagagttcgggctgtcaatgccatc
gggacaagtgatccatcagaaatatctgaaaatgttttcgcaaaggatcctgactgcaac
ccaagtattgaagtcaaatcacaggatgtcattgtcgtggagggtgaaaggttgaacgtg
cctttacccttcagagctgttccagcaccaactgtttcgtggcataaaaacggaagggaa
ctcaaagcagatgacagaatcactttgaagagtgattatatcagtgcctgccttgagatt
gctcgcagtgttcacgctgacgctggtgtctacacacttactttggaaaacaagctgggt
tccaccatcggtactatcaacgtgaaagtcatcggtttgcctggccagtgtaaaaatatt
aaggcaagtgaagtcactaaggattcttgcaagataacctgggatcctccagacaatgat
ggcggcagtcccgttttgcactatgtgcttgaacgtcgcgagtctggtagaagaacgtat
atgccagtcatgtctggtgagaacaaactcagttggtccttgaaagacctcatcccaaat
ggtgaatattacttccgtgtaaaggctgtgaacaaaataggcggaggtgaatacaccgag
cttcgcaatccagttatcgctgaagatccaaagcaacggcctgatccaccagttgatgtt
gaagaccacaatccaacatcaaaatcagtaacactcacttggaagccaccgctctatgat
ggaggctgcaaaatcatgggctatattattgaaaagatcccgaaggggagtgacaagtgg
gagaggtgcaacgaatacctggtgcctgttctgtcttacactgtaaagaatctcgaggaa
ggaaatgaatatcagtatcgtgtacgtgctgagaatgtagctggagttagcgaaccttca
aaactcactctaggaatcaaagctgtggatccagttgaacgacccaaggtcttcctgagc
ggaaacctagcgtctggattaagtgtcaaaagaggtgatcagattagcctcaacgccgtt
atttctggctctccttatccaagtgtgacatggattaaagatgaggaagtgattcggcct
gaagaaatcaaaaagagggaacgtaaaataatgccagtcaagaagaagcaggaagttgta
gaagaagagccgttctttctcagtctacccgaacgtttaagccttgacaatagcagacaa
ggagagtccaatataatggtccgcgattctattagacaggatcatggaaaatttacaatc
aaagtagaaaatgatcatggtatagccagagccacttgttacgtaaacgtgcaagatacc
cctggcccacctatcaacttcacctttgaggaaatcagaagcgattctctccgttgtaca
tgggatgctcctgtggatgatggcggtagtgaaatcctcaattatatcttggagaagaaa
gactactctaaacctgaagctggttggattacgatatcgtcaactctaaggcaacgcaaa
ttccacatcactaaacttatcgaagggaaggaatacattttccgtgtgacggcagaaaat
aaattcggcccaggaccaccatgtctctcacagccagtcattgccaaaaatccatttgaa
cctcctgaggcacctgagaaacctgaggtggtggatacttctagcaatagcatggttgct
gaatggaaagaaccaaaagacaatggaagccctatcataggctattgggtagaaaggaag
gaaattagcagtacccattggacccgagtgaatagacaattgctgaatgctctcaccacc
aaggctgaaggcctcatggaaggattaacgtacatattcagagtctgcgcagaaaatgca
gcaggtcctggaaaattcagtccaccttcagaacccaagattgctcaggaccctgtgtta
ccacctggcccaccaagaccaagaatcctagatacaagtgaaacgacaatagaaatcgag
tgggatcctccaatatacagtggtggtggcgatatcatcgggtatcatgttgacaagcag
atgctgggttcaaaggaatggtcacgctgcacagaaaggctagtcaagaaccgcacccta
tcagtcagcggggttcgagaaggcggcgattacaaaattcgtgttgtggcggtcaacaat
gctggagaaggccctcctggtgaaaccgaaactgtaaccgtgagggatccaaaagagcct
ccagtggttgagtttgacatctctgtaaaagcgggtgttcagcacctggccgggaaaacc
attagactgcctgccattgtcacaggccgacccccaccggaaatcaagtggagcaaggaa
gaaggggaacttgacaaagagcgcatccttgttgaaacagttggcaccagcaccgtgctg
gtcatacaagacgcgcgaagaagcgatcatgggagatacatggtcaccggcacaaacagc
agtggctcgaaatccgcagtgaccagagtagaagtgatggacgtgcccggccctgttctg
gatctgaaacctgtcgtcgttacaagaaagatgattttgctcaattggtctgatcccgag
gatgatggtggtagtgacctcactggtttcagtatagagagaaaggatgccaagatgcac
acctggagacagcctatagagaccgacagatctaagtgtgacattgttgggcttcttgaa
ggacaggagtacatgttccgtattattgctaaaaataagtttggtggtggtcctcctgtt
gaccttggacctatacttgccgtcgacccgcttggtccaccaacttcacccgagaggttt
atgtacacagagagaacaaagtcaacagtcacgctcgattggaagcctcctcgaaatgat
ggtggtagccccatcatcggatacattattgaaaagaaaaagcaagatacacctgaattt
gacagagttaacaaacagctatgtagagccacaaacctccttgtcgaaaacctagcagaa
ctgcacatgtatgagttccgtgtcaaagctgtcaatgaaatcggggaaagtgaaccgtca
ctgcctcttaatgtagtaatccaggacgatgaagtgcctccaactgtaaaactgctggtg
aaaatcaagagaaacactatttctgtcaaagctggtgaacccattgacatcccagctgag
gtggaagggcttcccctacccaagattgaatggaaaaaaggagagactgtgataggagca
tcgactgaccaactaaagatgcatactgaaatcttatcaagaactaatgcaaagaccaag
attcatatcgctgcatcggttagaaaggacacacaattgtacactatcactggttcaaac
cgtctcggaactgctttccagtctgtgaacgttgtcatttttgataaaccttcacctgtg
agaaagctcgtagtttccgacatcaagtctgaatcctgctatttgacttgggatgcaccc
gaagacaacggcggcagtgaaataacgaactacattattgacaagcgcgatgcatccaag
aagaagtctgagtgggaggagatcacaaatttcattattgaaaggagatacggagtatgg
aaactgacaacggacggagattatcaattccgaatccgtgcacagaacaagtatggaatt
agcgatgattgcgtttctgaaaaggtgacgatcaaagacccatttggcctcccgggacca
cccgccaagccaaaggtgtccgatgtcacgagactgacgatgcttgtatcttgggaacct
ccactgaacaatggtggtgctactatcacaggctactggctggagaagagagagctgggt
ggtgtgtattggtcccaggttaacagagctcctgtcaccaaaccctctgtaaaaggccta
gacttcaatgtcctccgcttgatagaaggtcttgaataccaattcagagtcatggctgta
aatgctgctggaattggacctcctagtgagccttctgatcctgtattggcagctgatcct
atatatcctcccagtactccatcggctttagaggtgactgacaaaactaacagtacagta
gcccttcgctggaagcgtccagacaaagatggtggcagcccgatcaaaggctacattgtt
gagatgcaagaggaaggctcgtctgactggaaaaacgtgtctgagccggataaacttctc
accaattgtgaatatgaggtgcccaatttacagacgcacaagaagtacaggttcagagtt
aaagcagttaatgctgcaggcgaatccgagccaagttcaacaacaacagaaatagttgtc
aaggaccttcttgaggaaccaactgtttcattagcaattaatgcacaagacttgctcctt
tgccgtgccggtacaacggtgaaaatcccagtaattgttaccggtcgtccttttccaaag
cttaattgggagtttgaaggaccagctaagaccgtcttgaaggatgacatccacaactta
ccagctgatgcagagcttgaaagtactaaaactactacaactgtggtaattccagagtgt
aacagcagccactctggccgctacagcatcaccgcgaagaataaggccggacaaaagaca
ttaaacatcagagtaaatattcttgatgccccaggcccgccgaaaaatctcaaagtcagt
gacattaccagaagcacctgcaaactttcatggaagcccccagacaatgacggtggagac
agaattaaggcctattatatagagaagaagactgtagaaggaagggcctgggtaaaggtt
aacactgcctgtgcagggacatcatacactgtgcctgatcttgttgaaggccaggaatat
ttcttccgtgtccgagcggaaaaccgatttggggttggtgcaccagcggaaactatccaa
aggaccagggctagagatccaatccatccacctgagcctcctacgcgacttaaaattgcc
ctcgtcacgaaaaatgctgtttctcttacctggcggccacctaagaacgacggaggtgct
ccggtgacccattacattatcgagcgtctcagctggaccaccacaggaaaagacaaggaa
tcgtggaagcaatgcaacagacgcgatgttgacgataccaagtttacagttgaggacctc
caggagggcggggaatacgaattccgtgtaaaagctgtaaatgaggccggtcaaagtaaa
ccatgtaaccccgttgggccaattatcgtaaaagatcaaacatgtggaccttcaattgaa
cttaaggaattcttggaggcagaagaacgtactgacatcagcattgtagccaaaattaaa
ggcgtacccttcccaactttgacgtggtgcaaggcgcctgctcacaaggcagaagagaag
tctaaagtagaatacgatcaacatgtcaacaaaattgtgaccgaggacaaatgcactttg
ttgattcatcagtccctccgaaaggacactggtctttacactctcactgcaacaaacaat
ctgggaacggattccaaggaaatgagactcaacgttcttggacgccctgggcctccggtg
ggtccgattaagtttgaaggcatttctgccgaacacataacgttagcgtggcttcctccg
aaggatgatggcggctccaagatcaccaactatgtagtcgaaaaaagggaagcaaataga
aagacttggatggaggttacaaacgaggttaaagagtgcctttgttcagtacccaagtta
ctggaaggccacgaatacgtcttccgcatcatggctcagaataaatatggtgttggtgaa
cctctcgacagtgaaccagaaacagcacgaaacctattcactttacctggtgcgtgtgat
aaaccaactataagcagtgtgacccatgattccatgatagtcaattgggaagatccagag
tatgatggtggttctccagtgacaggctactggttggagcgcaaagaaaccactggcaag
agatggaacagagtaaatcgtgatccgatcaggattatgcctctcggagtgtcttataat
gtaactggtcttattgaaggatcgaattaccagttccgtgtgtttgccatcaatgcagca
ggaattgggcccccaagtcagccttctgacccaacaatagcaagagatcctattgcacca
cctgggcctccattccctaaagtgactgactggaccaagtcaactgctgatgtggaatgg
gatccaccaactaaggatggtggatccaggatcactggctattttgttgaatttaaggaa
gaaggaaaggaagaatgggagaaggccaaagataaagaagtcagaggcacaaaatttgtt
gtctcgggactcaaagaaggaggtctgtacagatttagagtgagagcagttaatgcagct
ggagttggcgctcctggagagatatctgatgcacttgaagtcaaggataggacagaaatt
cctgacattgaattggacgccagcgtgcgagagcgaattgtagtacacgctggaggcgtt
attcgtatcatagcatacgtgtcgggcaaaccacctccacagatcacgtggcatagaaat
gatgaggccgtgccagcagaagctacaattgaagttacagctatcagctctgcactcgtt
atcaaaaagtgccagagaagccaccaaggcatctacaatctggtagctaagaacgtaggg
ggtgaacgaagaaagaccatcatcgttgacgttttagacgttcctggaccggttggcgta
cctttaaactttgaaaacctcaccaacgattctggtaagttgatctggttcaccccagat
gatgatggtggatctgctatcaccaactacgtcattgaaaagcgtgaagcagatcgtaga
ggctggacccccgtgacctacacagtcacccggcagaacgccgtaatccaaaacctgatg
aaaggaaatgcctatttcttcagaattgcagctgagaatcttattggcaagggaccgtgg
gttgagacaccgtacgagtatataattaaagaaccaatgtctgtccctgaccgtcctgaa
gaacttcaagtaacaggagtcacaaggaactcagttagcctcagttggaatcctcctaag
tataatggcggctctgatattactatgtatatcattgagtcccgtctcattggcaaagac
aagttcatcagaatcactaaagacaagcttcttaaccggaagtatacaagcgatggctta
aaggaaggtgacacttatgagttccgtgtcagtgcagttaatgttgttggccaaggcaag
ccatccttctgctcaaagccaataacgtgcaaggatgaacttgtaccccccacaattgag
ctggatttccgcgacaagtttgtcgtgcgtgtgggtgagtgtttcagtttgaacggacgc
tatgcaggcaaacccgcgcccaaagtttcttggcttaaggatgagacgaaaatcacggac
accgatcgtctaaagatccagacaactccaaagacactttgtcttggaatcctgaaaggc
atccgcgcagactcgggcaaatactgtgtggtcgtggaaaacagcacggggacacgcaaa
ggtgtctgtgaagtgactgtcgttgaccgcccacagcctccagttggcccggttgtgttc
catgaagtccacagagaccatatggttatttcctggaatccaccacttgacgatggtggc
agtgtgatcactaattacgtggttgaaaagagagatacaaaccgggatctctggatgccc
gttacttctgctgttactaaaacaacttgcaaagtaccaaaactgattgagggcagagag
tacatcatccgcatcagtgctgaaaatatgtatggaatcagtgatccattggaatctgaa
gaaattaaagccaaagatcggtttagggttcctgaagcaccagaacaaccagttataaag
gatgttaccaaggattctgttgtggtgatttggaatagaccacgagatgggggcaaacct
atcactaattacattgtggaaaagaaagaaaccatgtctaaccgctggtcaaaagcatcc
acggagcctatttacccagacacaaagtacaaagtgactgatctttatgaaggctgtgaa
tatgaattccgtgtctcagctgtaaatgaagtaggtgtcggtgacccgagcccaccatcc
aaacccgtctttgccaaggatccgatcgtcaaaccaagcccgcccgtcactcctgaagcc
gtggacaagactaaatctaccgttgacctgatttggctacctccacgtcatgacggagga
ggaaaaataattggctatttagtggagtaccaaaaagttggtgacgaagagtggactaaa
gccaatcatacggcagagtcgtgccctgacttaaaattcagggtaacaggtctcactgaa
agttatatgtacaaattccgcattatggctgtcaacgtagttggtgaatcagaaccagtt
tacgtccgtgatccagttgaagtaaaagaccggctcgaggctcctgaattgtttgtggat
gccaacatggctcgagatttaaacataagagcaggaagtgacttaaccctcagtgcaatg
atcaagggaatgccattccccaaggtcacctggcaaaaggaggataaagaagtaccaatg
aaagctgacattggggttacaccagttggcagcaagcttcaaatctgtaacgctgtcagg
ggtgacagtggacattactcactgactgttgaaaatgaagcaggaaagaagtctgctaca
tgcaatgttttcgtattagacaaacccagtccaccacatacctttactgttactgaagtt
agaagtaactcatgctatctgatgtggaaggaaccaattgacaacggaggtgctgttatc
tcaaattacataattgagaaacgagatgtttcagctccacagtgggttcctatctcctct
tcgtccaaaaagcacagcattatggccaagtatttaatggaaggcactcagtatttgttc
cgtgtggctgctgaaaatcaatatggcagaagtgcctttgttgaaaccaaaaaaccaatc
aaggcaattgatccattatctcctcctggtcctcctaagaacttgcatcacgttgatgta
gacaagaccgaagtgtctattgtttggaattacccagatcgtgatggaggtgctcccatc
acaggctttttagttgaataccaggaagaaggcgcacaagactggattacattcaaaact
gttagcattccagaatgcacagtgacacatttggaggaaggaaagatatatcggttccgt
gttaaagctcaaaatatagttggctttggtcgtccagatacaacagtgcctgtactatgc
caggagaaaatagtaccaccaactatagatttggatgtgaaattgattgaaggtcttgtc
gtcaaggctggcagcacagtcagatttcctgcccttatgaagggtattcctgtaccttca
gtcaagtgggtcattgacagtgttgtgatcaaatcagaaggccattacaaaattaacact
gatggccactctacaatccttactattgaggagtgtaacagaaaacatagcggtgaatat
ttgcttaccgtttccaatccagctggtagcaagacagttgctttacatttaaccgtcttg
gatgtccctggcccgccaattggtccagctaatatcctggaagtaaccccagaacacatg
gtcgtgtcctggcgtccacctaaagatgatggaggaagtcctgttatgaactacgttgtt
gaaaagcgagaaacgaagaaggagacctggggaattgttagcagtggaagcacaagtacc
agagttaagattccacgtcttcagaaaggatgtgaatacattatgcggatacgagcagag
aataaaatcggtattggtgaaccattagactctctgccaactgttgccaaacatacattt
gatgtcccgtcaccacctggtaaaccagttgtttatgatattgcagaaaatgccgtaaca
gtttcttggggcttaccaaagtctgatggcggaagcccaattaatggttacatactggag
cgcagagaaatatctggcaaatggattcgggtgaacaagacacccgtattagatattaaa
ttcagggccgttggactatttgaaggcaattcataccaattcagagtatttgctgaaaat
attgctggtctgagtaaaccatcaccaaactctgatacagtagcagccaaacgacctatc
acagcccctggaccaccaattaatcccaaactgaaggacaaaagtagggaaagtgttgat
ttagtctggataaagcctaacaaggatggaggcagccctatcttgggatacattgtagaa
tgtcagaagacagatagtacgaaatggattagagtcaacaaagatgatttgatcccgcaa
tgtgcttacagagcacatggtctaattgaaggcaatgaataccgcttccgtgtaaaagct
gccaatgttattggggaaggtgagccaagagaattaccagaaactgtgatcgcaaaggac
attcttcaacctccagagatagacctggatatcgtttgccgtgaactggtcacagttcgt
gtgggacaaaccatctgtataagtggccgtgttaaaggcagaccagatccagacatcaca
tggtcaaaagacagcaaggtagtctctcctgacaaacgcacagagatcaataacgattat
ccaattataaggctccacattaaatcagcaactagagctgactatggaaaatatagcgtc
gttgccaaaaatagtagcggacaagttcaggctgctgttgttgtcaatgtacttgacaga
cctggacaatgtcaaaatatcaggacaaattacatcaccaaggattcttgtatgcttgct
tgggacaatccagaagacaatggcggctcagaaatcactaactatattgcagaatgccgt
caacctagccagagaggatggtctatgatctcagcagatttgactaagcgcatagtcaag
gtacagcttgtaccaaatcaagaatacttcttccgtgtttgcgcagaaaacaaagttgga
ctggggccgactgttgagaccaagaccccaatcctagccattgaccccgttgaaaaacct
ggagcacctgaaaatttccatgttgccgaaacaggaaagtcatttgctcaacttaaatgg
aggaaaccggattttgatggtggtagtcccaatctgtcgtatcatgttgaaagaagattg
aaagacactgatgaatgggatcgattacacaaaggcagtattaaagacacgttctttatg
gctgaccggtgcattgagaaccagacctaccaattcagagtacaaaccaagaatgatggt
ggcgaaagcaactgggtgaagacagattacattgttatcaaagaagaaattcagaaacca
gtcttggatctaaagctatctggaatattaactgttaaagcaggagaaaccattagactt
gatgctgatcttagaggcaagcctgcgccagaggtgacgtgggttaaggacaaagatgca
attgactttgctagattgcctcgagcaaagattgaaatcaccccggaatcagcccgattt
gccctgattaaggctaaacgtagtgactcaggcaaatataccattattgcaacaaatata
gctggtagcttcacggcctatgccattgttcatgttttggatgtacccggagccgtcaga
gacctaaagatctctgccattgcaagcgatcgatgcagagtcagctgggacgcaccagaa
gatgatggcggctgtgaagtccaaaactatgtgatagagaaatgtgaaaccaagagaatg
atctggtccacatattctacttcagtgcttaacgagtatgcaaacgtcactcgtctcata
caaggaaatgaatacatcttcagggtacgtgcagaaaacaaaatgggcactggaccaccg
actgaaagtaaaccagttacggccaagacacaatttaacagacctggccctccagacgca
ccagagatcacaaaggcgagcagggaagaaatgactgttgtatggaatccaccagaagat
gatggtggcaaatcaatcacaggttacatattggagaggaaagagaaactatctattcga
tgggtacctatcaccaagactgcaatcacagaaagacgcatgagggtgaaaaatttgact
cccggacgcgaataccagttccgagtcaaagcagaaaacgaaattggaattggagatccc
agtgggccttccagaccagtattcgcaaaggatcctatggaaccacctggtcctccaact
ggtctgaaggtgtcggacagcaccaagacatccgtgactcttagttgggggaaaccagtg
tacgatggtggctctcccatcattggttatgtcgctgaaatgagactgaaaggttcaagc
gaaggtcctgaagaaggttggaagagatgtaacgttgcagctcagcttgttctcactcag
tttacaatgacaggccttgatgagaagcaagagtacgaatttagggtggcagcaatgaat
caagttgggctcggtcgtcctgctgaactcaaagaagctgtatctccaaaggagattcta
gaaccaccagagattgacttagacgcaagcctgagaaaagttgtagttgtccgagccggg
tgtcctattcggttgtttgctaccattcgaggccgaccggcaccaagggtctgctggaga
aaaatgggaattgacaatgtggtcagaaaaggcctagttgacctccttgacacaatggct
ttcctcgtcatcccagatagtactcgagatgatgctggcaaatattcattgacactggtg
aatgcagcgggcgaaaaggcagtgtttgtgaatgtgaaagttcttgacacacccgggcct
gtctcagattttgaaacttcagacgttggaaaaatgacatgtcagctctcttggtcacca
cctgataatgatggtggcagtccagtgacccactatattctggagaaacgcgaagcagat
aggaagacctgggcttcagtaataccagatttgaagaaaactagcttcaaaataactaac
ttggtacctggaaatgactattatttcagggtgaccgctgtcaatcagtacggttctggg
gttccaaaggatactgctaaatctattgtggcaagagatccaattagcgaaccagatcca
cccaagaaagtggaggtcacagatggcacaaagagctctgctacggtggcctggttgaaa
cctctcagggacggaggttctaaaatcgatggatatatcgttgaataccaggaagagggt
caaactgagaaagaatggacgcaatattctgtagtcaaggacctgagcattgttgtgatg
ggtcttaaagaaggaaagaaatataaattcagagttgcagcaagaaacattgtggggtcc
agcttacccagagaaactgaaggattctttgaggttaaagaacaactaatggcaccaaag
attatcatggcagagaacataactatcaaagctggcaagaagttaagagttgagtctcac
atatttggcaagcctgcaccaaccttcaaatggcagaagaatgatgaagatgtgatgcca
tcgagccgtctagccgtgcacaagtcaaagggtgcttctgtcctcatcatcaaagacgtt
agcagaagtgacagcggcttttacaatcttatagcagaaaatagctctggcattgcctcc
cagaaggttcatgtcgtgataatggatgccccaggcccaccagaaccaccgtttgatatt
acagaaattgacgcagatgcgtgcaccctcgcttggcacacaccacatgaaaatggcggc
agcaacataacaaactacattgttgagaagtgtgatttaagccgaggtgactggatcact
agcgtgtcatctgtatcgaaaaccagctgcagaattggaaaacttatgcctgggcaagag
tacatgttccgggtccgagcagaaaataggtttggcatttcagatcctcttacttctggc
aagatgattgctaaatatcaattcgatattccaactgaaccaagaaatgtacatttaaca
aaggtgaacaaagattgcatatttgttgcatgggatagaccagaaagtgatggtggcagt
cccatcaccggttacgttatcgaacgtaaagagagaaacagtcttctttgggtgaaggct
aatgacacagctgtccgtacaactgaatacccatgttcaggtctcattgaagggctggaa
tatactttcagagtcattgcactgaacagagctggagccagcaagcccagtaaaccaact
gagtttgtaacagcaagaacacctgttgatccaccaggcaaaccagaagtattcgatatt
acacagagtactgtggctcttctttgggcaagacccaaacatgacggtgggagcaaaatc
cttggttactttgtcgaagcttgtaaactaccaggtgaaaagtggatcagatgcaactcc
aactgccacaacgtacctcttgaagaatatactgttaccggtcttgaagaagctgctcaa
tatcggttcagaatcattgcgaagactgtcattaacattagcaagccatctgaaccttca
gatccaattaccatccaagcagaacatgatgcgcccaaaattgacttgggtgtgtccatg
aagagtcttatgactgtgaaggctggagtcaatgtttgcttggaggctgttgtctctgga
aaaccttttccgaaagtcagttggaagaaaaacggcaatgaggttgtgcctgctgatggt
ttcaagataacaaccacaagaagtttgtgtactctggagttatattccgttcaaaggaag
gaaactggagaatactctattttcgcagagaatccaagtggatcgaaatcggctcacgta
aaacttaaagtactagacaaacctggcccacctgcttctgtcaaaatcagcaacgtttac
tcagatcgtgttaacctcagttggctgcctcctctagaggacggaggtgccgatgtaacc
aactatgttgttgataagcgtgaaacaagccggcctaattgggctcaggtcactgctaac
gtcccaattactagctgcggcatagagaagctgatagaaggacacgaatatcagttccgc
atctgtgctgaaaacaaatatggtgtcggtgaccccatcctgactgaatccgttgttgcc
aaaaatccttacgatgtccctggacaatgtgatcctccagtgattagtaacgccacaaag
gaccatatgactgtgagctggaaacccccagctgatgatggtggttcagctataactgga
tacttactagagaaacgtgagacaaaggtcgtcaagtggtccaaagtcaacaggagacca
gtcatggaaagaacagttaaggcgacaggacttcaagaagatttggagtatgagtatcga
gttattgctttgaacaaagctggaccaggcaaacctagtgaatcctcaaaatcagcaatt
gctgttgatcctcaatatcctcctggcccccctgccttccccaaagtgattgacacaact
cgcggcaccgtcagcttgtcttggagtaagccagcgtatgatggtggaagccctatcctg
gggtacctggtcgagattaaactcgcggatactgaaaattggatgaaatgtaacgtgcca
aagaaccttcaagaaacgcgttatattgttacaggactgaacgatagcactgagtatcag
ttccgtgtatctgcagtgaacaaaatcggcttcagtgatccaagtgatgtgcctgataaa
catattcccaaagatattttgattgctcctgaagctgatcttgatgctgacttaaggaag
gcacttattctgcgtgcgggagtcacaatgaggatctacgtgccagtcagaggtcgtcca
actccaaaagtcacgtgggcaaaaatgaataccaacatcaaggaaagagaaggacttgaa
atcagaacttcagaatacgatacaatgctgtactgcgaaaacgtcaatcgatatgacggc
ggaaagtacattttaactttagaaaacagcagtggaatgaagacatatacacttgttgtc
aaggttctggactctcctggtcctccgcttaaccttgtggttaaagaaacatcaaagaat
tctgctgctatttcctgggatcctccacttgtggacggtggtagtccagttaagaattac
attgtggaaaaacgagatgctgaaagaaaggcatggtcaactgtatcaactgagtgtccc
aagacaagtttcagaattcagaatttggaggagagtaaattttacttcttcagagtgctg
gctgaaaatgaatatggcatcggcgtgccttgtgagacaaagaatgctgtgagagcttca
gaggaacctggacctgtgatcaacctgaaggctttaacgttgaccaaatcatcttgcacc
ctggcatggaaaaagcccgccagtgacggtggatcacgaattacagcttatgttgttgaa
atattgctggctggagacaaatggaaagagttaatgcagtcaaagaacatgcaacatcca
ataaaagatttggaggaaggaaaagaatatactttcagagtgagagcactgaatgatgca
ggatacagtccaccagaggaaattacagttgtagccaaggatcaagttgtaccaccaaat
attgatctgagagacctgcctgacttaacttacgttgccaaggagggaagcagcttccgt
ctgaagattccaatcagtggaaagccagtcccaaaagtaacatggaagaaaggtgaagac
ccgctcttggatgagagtggcagagttgttgtggaatccactgctgtcaatacaacatta
atagtacgggaatgtcaaaagagcgatgcctcaaagtacacagtcaccgtgaagaacacc
gccggcacaaaggaaggcactctgttcatcaaaatagtgggaaagcctggaataccaacc
ggacctctgcgtttcgatgaagtcacggcggatgccattactttgatctggggagctccc
aaggacgatggtggttcagaagttacaaactatatcctggaaaagcgagataacacgacc
aacaaatgggtgacgtgcgcctctgctgtacagaagacaacattcagagtcacaagactt
cacgaaggaattgagtacacctttagagtcagtgctgagaacaagtatggagtaggcgta
gacctgaaatctgatcccgttatagccaggcatccgtttgatgtacctgatgctcctttg
ccacctcaagttgttgccgccagacatgactctgtgtcattggtttggacagaccccagg
aagacaggtggttcacctatcacaggttatcacattgagtacaaagaaagaaacggcctt
ctgtggaaacgagcaaataagaccccactgagaatgaaggatttcagagtaactggcttg
acagagggacttgaatatgaatttagagttatggcaattaacttggctggtgtaggcaaa
ccaagtccaccaacgaagcctgttaccacacttgatccaattgatccccctggaaaacct
gatgtcattaacatcacaaggaactctgtgaccctcatgtggactgagcccaagtatgat
ggtggacataaactaatcggctacattgttgagaagcgggacctcccttcgaaaatctgg
atgaaagcaaatcacgttaatgttcaggactgtgccttcactgtcactgacatgactgag
ggctgcaaatatgacttccgcattaaagcaaagaatgcagccggagcaatcagcgagcca
tcggaaacgacaggaaccattgtgtgcaaggacgaatatgaggcaccaacaattgtaatt
gatcctactgtaaaggaaggcttaacagtcaaagctggcgatacaatcgtgattactgcc
accagtattctcggcaagcctccgccaaaatcagcttggtctaagggtggaaaatacttc
aagccctctgacattgtccaaattgaagacactccgacttcctccatactatctgttaaa
tatgctacaagaaaggattctggagaatataccatcactgccagcaacccgtttggtatc
aaagaggaaaatgtccgtgtgaaagttttggacgttcctggtcctccaggccccattgaa
gtcagcaatgtctcatctgaaaaggtaacactcagttggtcgcctcctgcagaagatgga
ggttctccggtcaaatcctatacaattgaaaagagagaaaccagtcgccttctctggact
ttactcgcggaaaatctcccaagctgcagatatgtcgcaagcaaacttatacaaggaaat
gaatacatcttccgtgtctctgctgtaaatcagtatggcatcggtgacccttcacatggc
gaacctgttaaaatggtagatagttttggtccacccggtccaccaggaaagcctgaaatc
accaatgttaccaaaaacacagtcaccatttgctggaagagaccagttgatgatggtggt
agtgaaatcctaggatacattgtcgagcgtaaagaaaagaaaggtctgagatgggttaga
acaagtaaaaaatcgatttcagatctacggcataaagcagtaggacttaatgaaggaact
gagtatgaattccgggtcacggcagaaaacaaagcaggcatcggaacaccaagcgaacca
tcagcatcagtgctgacaaaagacttagcatatgtgcccgggcctccttctaacgcaaga
gtggtggacacaacaaagaccaccgctactttgacttgggggaaacctcactacgatggt
ggccttgacattatcggctacatagttgaacacaagaaagaagcagaggaagaatgggta
aaagacaccacgggcactgcactcagaataaccgaatttgttgttgctaaccttcagcca
ggggaaaaatatcactttagaatcagagcactcaatgctgaggggattggtgagcctgct
caagttgatggtgcggttgaaattaaggaacgtgaagaagtgcctgattttgagctggac
gctgatctgagaagaactcttgtcgtcagagctggagtcacaatccgcatctttgtacca
atcaagggccggccaactcctcaagtcacgtggcttaaaggagatagtccggtcaaagga
cgtgccacagtagaaactacatcttcatacaccttcctcctgatccctgaatccaccaga
gatgacactggaaagtacacaatgtgtcttgaaaatgctgccggtaaaaagtctggtttt
gtaaacgtgagggtcctagactccccaggacctccgattaaccttaaagccagagaagta
acaaaagatagcattacattggcttgggaactgccaatgattgatgggggctcacgggtc
aaaaattatataatagaaaagcgagaatcgacacgtaaagcctatgctactgttacaaca
aactgccaaaagtgttcgcttagaattcccaatctctcagaagggtctgagtattacttc
agagtaatggctgagaatgaatacggcattggggaaccagctgagacgacagaccctgta
agagcatccgaagccccgtctcctccagaaagtcttcacatcatggatataactaagcac
acagtcagcttagcttggccaaaaccagagttcgatggtggtagtaggattacaggatac
gtacttgaggcccagaagagaggcagtgaaaaatggatgcctttagcaactcaaaaggca
ttagattatactgtaaagaatttgactgaaaatgaggaatatacattccgcatcatggct
gtcaatatttctggaaggagcgatcctcgagaaagcaggcccgttgttgtaaaagaacaa
acgtcacttccagaattggacttgcgtggtatataccagaagactataattgcaagggca
ggagataatatcaaagctgagatcccagtgcatggtcgaccaaaaccaacagtcacctgg
acaaaggaaggccaaactttgaagcaaacgcagagaataaatgtcgaaaatacagccaac
tcaacaatacttaacatcaacgaatgcacaagaaatgataccagcaagttcactctgacc
gctaaaaatataatcggtgaagtaagtgacaccatcagtgttcaagttcatgacattcct
ggaccacctaaaggccccatcaaattagacgacatttcatctgtttacattttgatgtca
tgggaaccacctgagagtgatggtggagtaccaatcaacaactacattgtagagatgcgc
gagaccaacagcacatcatgggtagagctggcagctactgtgatacggacaacatttaaa
gctagtcaccttaccactggaatggaataccaattccgaattaaggctcaaaacagatat
ggtgttggacctgccattatttcagagtctgttgttgctgcatatccatttaaggtgcct
ggacctccaggaactccaagtgttattggagtcacaaaggattcaatgactatcacttgg
aatgacccagttactgatggtggaagtcaaattttgggatatcatattgaaagaaaggaa
agaaatagtattctctggcaaattataagcaaggctttgattgcaggcaacacatttaaa
tcaagtggacttactgatggcattgcatacgaattccgtgttgcagcagaaaacatggct
ggcaaaggaaaaccaagtaaaccttcagatccagtatttgcgctagatcctatcgatccc
cctggtcaaccaattcccgttaacattacaagacattctgtaacacttgtctggacaaag
ccagaatatgatggaggctttaaggtaactggatacacgattgaaaagagggaattcccg
agtgggcgatggctcaaggcaaactttagcaatgttctggagaccgagttcacggtcagt
ggccttactgaagatgacaaatatgaattccgcatcatagctcgaaattcagcaggagca
gtgagcaagccatctgagcccactgacgcaataacatgcagagatgacgttgaggaacca
aggataatggtggatgctaaattcaaagatgtcatacttttgaaagctggtgaagttttc
aaactcgaggcagacgtaacagggcgaccaataccaacaatggtctggacaaaggacgca
aaggatcttgtagaaatgggaaaacaggaaataaagatcactgatttctcgacggttttg
atgaacaaagatagctcaagaaaagatggaggtgcttacgtacttaccgcatccaatcct
ggtggctcagttaagcatgttttcaatgtcaaagttctagatagacccggccctcctgaa
ggaccgataggaattacagatgtcacatcagaaaaatgtgtgatatcatggttaccacct
ccagatgatggtggtgcaaagattgatcattatgtcattgaaaagcgtgagaccagtcga
cttgcatggacaactgtatcagcagacgttcaagtcaccaaactgaagataaataaactt
ctcaaagggaatgagtatattttccgtgtcatggcagtgaataagtacggagttggtgaa
tcattggaatctgaacctgttatcgctgctaatccatttgtcccacccagcccaccgaag
acaccagaggttacagcaatcacaaaagattcaatggtgatttgttgggggcatccagat
tctgacggtggcagtgaaatcaccaattatattattgagcggcgtgacaagacaggatta
cgatgggttaaatgcaacaaaagaccagtcactgatttgcgattcaaaactgttgggctt
acagaaggacatgaatatgaatacagaatcgtagctgaaaatgctgcaggtcttagtcaa
ccaagttctaccagcccattctataaatcttgtgacactgtattcaaacccggacctcca
ggtaaccctaggctgcttgattcgagcaaatcttcaattactattgcctggaataaacct
atttatgatggcggttcagaaattacaggttatgtggttgaaacgtgtcttcccgaagaa
gatgaatggacaattgtaacaccacaggctggacttaaagccacatcgttcacaatcacg
aagttaaaggaaaaccaagaatacctggttcacatatatgctgtgaatgttgaaggcatt
ggtgaacctgcacaaatcccaggaacagttaaggctgaagacagattgttacctcctgag
attgatcttgatgcagatctacgaaaagtggtatgtataagagcctgctgcactttgaga
ttgtttgttactgtgaagggaagaccagttcctgaaatcaaatgggccagggaagatggg
gagccactggacagagcgtcgattgaaactaccagctcgtacactcttctcattatccca
aatgtgaacagattcgacagtggcaagtacatgttaacagtcgaaaatagcagcggcagc
aagactgctttcgtaaatgttagagttctggatactccaggggcaccgcagaatctgaag
attaaggaagttagcaaggagtccgtcaccgtttcatgggagcccccgcttatcgatggc
ggttccaagatcaacaattacatagtagaaaaacgagaatccaccaggaaagcgtactcc
acagtcatcgccaactgtcacaagacaacctggaaggtgggcaccttacaagaaggttgc
aactattacttccgtgtcctggctgaaaatgagtatggagtgggtcttcctgttgagacc
tctgatgcagttaaggtgtcagaaagaccgcttccaccaggcaaagtaaccttggtagat
gtaacaagaaacagtgcaattctgtcgtgggagaagccagagcatgatggaggcagccgg
ttattaggatacattgtggaaatgcaaagtaaaggaagtgaaaagtggacaacatgtgct
actgtgaagcttactgaagccaccataactgggctgacccaaggtgaagagtatatgttc
cgagtatcagcacagaatgaaaaaggtgtcagcgatcctcgacaactgggcgtccccgtt
attgcaaaggatctcataatcgttccttcttttaaacttctgtttaccacgttcagcgtc
ctagcaggagaagacttgaaagttgatgtgccatttattgcgcgtcccaaaccaacaata
acatggctgaaagacaaccagccattgaaacagacaaccagagtcaatgctgaattgaaa
gatagtaaggcacttctagtaattaaggaagcttgtcgcgatgatgttggccactacacc
ataaaactagcaaatgctgctggcgaaacaattcaaattcttggtattgttgttttggat
aagcctggacctccaactgggccaatcaagatcgatggggttactgcagacagcatgatt
ctcacgtgggaaccaccagaatacgatggtggatgtcaaattaataattatattgttgaa
aagagagacacttcaactactgtctggcagattgtgtctgctactgttgccagaacaaca
atcaaagccatacgtttaaagactggtattgaatatcaattcagaatcgcagctgagaat
agatatggaaagggcagctttcttgtttccgagtctactgttgcacaatttccctacaag
tcccctggtcctcctggtactccttatatgacgcatgttacgaaggagagcatgctcgta
caatggaatgaacccgtcaacgatggtggcagtaggattttgggctatcatcttgaacgc
aaagaaagaaacagcattctatggatcaaaatgaacaagtcaattatttccgacacccag
atgaagtccagcaatcttgaagagggcattgaatacgagtacagggtgtatgctgagaat
attgttggcattggcaaacctagcaaagtatctgaatgtgtcgcagctcgagatccatgc
gatcctccgagtcgcccagaagctgtgattgttaccagaaattcggtgcatcttcagtgg
aacaaacccgaatacgatggaggaagcaaaatcattgggtatattgttgagaagaaagaa
cttcctgaaggccgctggatgaaggctagcttcactaatatcattgataccaattttgtt
gtaactggtttaatggaggaccagaggtatgagttcagagtgattgccagaaatgcagct
ggtgtgttcagtgaaccgtcagaaagcactggtcccattactgccagagatgaagttgac
ccaccccgagttagcatggatccacaatacagggaagctgttgtggtaaatgcaggtgaa
gtatttaagatcgaagctgacatttttggcaaaccaatcccaacaatccagtggctgaaa
ggagacaaagaactggaaaacacagccaggctcgaaattaaaagtaccgatttcaatacg
gctctcacagtcaaggaagcaattcgagtggatggcggccagtacacacttttggcaagg
aacgtagcaggtgaaaagattgttcatgtaaccgtgaaggtgcttgacagaccaggaccg
ccagaaggaccaattgttgtaactggattgactgctgagaaatgcacattggcgtggaag
ccaccaacccaagatggagggagtgcgatttcccactacgttattgaaaagcgagaaact
agtcgcttggtctggacagtagttgactccaatgtagtggctctgagttataaagttacc
aaatttctggaaggaaatgaatacatcttccgtgttatggcagtaaataaatatggtgtc
ggtgagtcactggaatctgaagcagtaatagcaaagaatccatttgtgccccctgatgca
ccaaagacacctgaggttacggctattacaaaggactcaatggtcgttgtatggggaaga
cctacatctgatggtggtagtgaaattcatggatatattttagagaagcgtgacaaagca
ggaatacgatggacaaggtgtaataagcggctggttactgaactccgattcagggtgacc
ggattaatggaataccatgattatgagtttagagtatctgctgaaaatgctgctggcatc
agtgtcccgagtttgtcctcccctttctacaaggctgctgatccgatctacaaacctggc
ctacccaacaatcctaaagtcactgacgttacaagatcttctgtttctctttcatggagc
aaacccatttatgatggcggatgtgaaatccaaggatacatcgtagagatgtgcgacacc
agcactgatgaatggataatgtgcacggcagcaagcggcattaagcagactcaatttcaa
gtgaataaattggtggaaaagcatgaatacaaattccgtgtctgtgctgttaataaagct
ggagttggtgaacacgctgattttcccgacactgtccttttggaagataaattagaagct
ccagacgcagatcttggtgccgacttgaggaagatcattaatgtaagagctggttgttct
ttgagattgtttgttcctatcagaggatgtcctgctccagaagtgaaatggactaagtca
gatggtgaaatcagagacactgcacaaattgatgtgtctgagagttacacgatgcttgta
attgacaacgttaacagatatgacaccggaaaatacatgttaaacttggaaaacagcagt
ggatcaaaatccgcctttgtcagtgtcagagtgctcgacacaccaagtccaccaattaat
ttgaaagttaaggaggtaacaaaggaacacgtaaccttatcctgggaaccgcctaagttg
gacggaggtgcgaagattaagaattatatcgtagaaaagcgggaatccacaaggaaagct
tactctgccgttgtcaccaattgccataagacttcctttaaaatagaacaactccaggaa
ggttgcagttactatttcagagtctgtgccgagaatgagcatgggattggattaaccgca
gaaaccgttgaccctgttaaaatatctgaagtgccacagcctccaggaaaaataacagtg
gttgacgtgacaagaaattctgtgtctttgagttgggagaaacctgaacatgatggcggt
agcagaattatccagtacgttgtagaaatgcaaagtaaaggaagtgaaaagtgggcagcc
tgtgcacatgtaaaatcccttgaaacagtcatcacgagcctggtacagggagaagagtac
tcgttcagagttatggcagccaacgagaagggcaagagtgatccaagaaccctagcagta
ccagtgattgccaaagatctagtgattgaaccagacgtcaggcctgcatttaacagctat
aatgtacaagtaggacatgatttgaaagttgaaatccttatctctggacgacctaaacca
gtgattatttggacaaaggatggccagtcactcaagcagacaacccgagtcaatgttgct
gacaccagtcatcatacagtgctaagcatcaaggattcggttaaagaagacagcggaatg
tatgccattgccgtgagcaacattgttggccaaaagacagcgtctttcgaagtgataacc
ctagacaagcctggtccacccagtggccctgttaagtttgatgccgttagtgctgaaagc
atcacaattgcttgggaaccaccagcctttaccggtggctgtcaaataagtaattatgct
gttgaaaagagagatacgactacgacaacctgggagcttgtttcagctacagtggcaaga
acaactctcaagataaccaaactgaaaacaggaaaagaatatcagtttagaatatatgcc
gagaacaggtacggtagaagtttcgctttagattctcaggcgattattgcccagtatcca
tacaaagagcctggcccaccaggtacaccatttgttccaaatgctacgaaagagaccatg
attgtggaatggcatgaaccaatcaacgatgggggtagcagaatcgtaggctatcatctt
gaacgcaaggaaagaaatagcattctttggtccaaagtcaataaaagcatcatacaagat
acacgattgaagatcaccggactcgaagaaggaattgaatatgaattcagagtatacgct
gagaatatcgttggaattggcaaatcaagcaagatctctgagtgctttgttgcccgtgat
ccatgcgatccaccaggctgcccagaacctcttattgtgaccagaaatgcaataacactt
cagtggacaaagccagaatatgacggtggcagtataattactggctacattgttgagaag
cgtgacctacctgagggtcgctggatgaaggctagttttacaaatatcattgaaacccaa
ttcactgttactggtctcactgaggatgacaggtatgacttcagagtcattgctaaaaat
gctgcaggtacaattagtaaaccatctgatagtactggggcaattactgcaaaggatgag
gttgaaccacctagaatatctatggatcccaaatacagagacacaattgtggttaatgca
ggtgatgtattcaagctggatgctgatgttcatggcaagccattacctgttattcagtgg
ttcaagggtgacaaagaagtggaagaatcagcaagacatgagatcaaaaacagtgacttc
aaagctctgattgttgtaaaggatgcaatcagagtggatggcggacaatacattcttcaa
gtctctaacgtggcagggacaaaatctgttcccatcaacgtaaaggtcttggacagacct
ggacctcccgagggaccaatccaagttaccggcgtcactgctgaaaagtgttctcttgct
tggagtccaccacagcatgatggtggaagtaacatttcacactatatcattgagaaacga
gaaaccagtcgtctggcctggactgttgtgacttcagaccttcaaactactatgcataaa
gttaccaagcttttggagggcaatgaatatatcttccgtatcatggccgtcaacaagtat
ggtgtcggtgagcctttggagtctatacccgttatgatgaagaacccatttgtacctcct
agtccacccaaatcattggaagtaaccaacattgcaaaagactccatgactgtatgctgg
aacagaccggacagtgacggtggaagtgaaatcataggttatatcgtggagaagagagac
agggctggaatcagatggacaaagtgtaaccggcgtagaattacagacttgcgattccga
gtcacagggctcgtggaagaccatgaatatgaattcagattgtctgctgaaaatgccgct
ggaattggccaaccatctccggcctcagttttctacaaggcttgtgatccagtgttcaaa
cctgggccaccagctaatccacaccttgtagacaccacaaagacttctgtcgtgcttgtt
tggggcaaaccaatttatgatggtgggtgtgaaattcaaggatatttagtagaaatccgc
aaagcagacgaggaagactggaccatgtgcactccacagaccggtttacgagtaacccgc
tttgaaatcggaaaactcattgaaggacaggaatataatgttcgtgtatgtgccatcaac
aaggcaggagtaggtgagccagcaacagtacctggcgcagttaaaccagaagataaactt
gatgcacctgaaattgaacttcaggcagaattaaggaaagggatcacagtcagagcaggt
aatactgccaggatctttatagcatttaaaggcagacctgctcctgagattagttggtca
aaggacgagggtgaaatgaatgaaaagggacaagtagaaaagggacacaactatacgcag
gtgacgatagataactgcgatcgaaatgatgctggaaaatatattttgactctagaaaac
agtagtggcaccaaatctgcatttgtttcagtcaaagtgttggacacacctggagctcca
caaaacctagctgtgaaggacataaagaaaaactcagctacactcacatgggatccaccc
attattgatggaggtgcaaagattaaaaactatgttattgataagcgagaatcaaccaga
aaagcttatgctaacgtgaccactaaatgtaacaagtgcagctacaaagttgagaatctt
gctgaaggagcgatttattacttcagagtcatggcagaaaatgagtttggaattggtata
ccagttgagactctggactctgtgaaggcttctgaggtacctttaccaccaggtaaagta
actctcactgacgtcactcagcagagtgtctctctagcttgggagaagccggaacatgat
ggtggcagcagaattatgggctacttggttgaaatgcaaccgaaaggatctgaaaagtgg
ggtcttgtgtcccagtctaaaacatgcgaggcagtagttgctggtctcagttcaggacat
gaatatctcttccgtgtattagctttcaatgagaaaggaaagagtgacccaagactcctg
gcggtaccagtgatagctaaagatcagaatattgaacctaccttcaaactcgtattcaac
acctatagtgtcaaagctggagacgacctgaagattgaagttccagtgatgggacgtcca
aaacctaagattatttgggcaaaggatggacagtcactgaaacaaacaacaagggtaaat
gtggaggaaactgcaacctcaacaatccttctgattaaagacagtcataaggatgacttt
ggaaagtattcagttagtgctacaaacagtgctggatcagccacagaagatattagcatt
atagtgcttgataaaccaggtcctccaagcgggccaatacgatttgatgaagttagtgct
cagtttgttataatttcatgggatgcacctgaatacaccggaggttgccaaattaacaac
tacattgtggagaagcgggatacaacgaccactgcttggcaaatcgtctccgcaactgta
gctagaacaaccatcaaaataatgaaactgaacacgggaagtgaataccagttcagaatc
tttgctgaaaacaggtacggcaagagctcatctttagattctaaagcagttgttgcacaa
tacccatacaagatgcctggccctccagctactccaattgtatcagctgcgacaaaggac
accatgcatatccagtggaatgaaccagtaaacgacggtggaagtaagattttgggttac
caccttgaacgtaaagaaaggaacagtattctttggataaaattgaacaaggtgatcatc
caagacactcatttcaagtgtaacaatctagaagaaggtattgaatatgagttcagagta
tttgcagagaatattgtcggcatcagtaaacctagcaaggtatctgaatgttacgtagct
cgagatccttgtgatcctcccggccgacccgaagccgtcatcatcacaagaaataacatt
gttctccaatggacaaagcctccatatgatggtggtagcaagatcaccggatactttgtg
gaaaagaaggagcttcctgaaggtcgctggatgaaggccagtttcaccaacataatcgag
actgaatttaacgtgactggattaactgaagacgcaaggtatgaatttagaataattgca
agaaatgcagctggtattttcagtgaaccatctgaaagcactggaccaattacagcaaga
gatgagatcgaatcccctagagcttccttggaccccaagtacaaggacgtgatcgttgct
aatgcaggagacagctttgcactggaagctgatatctatggtaaacccatacctgaagta
aaatggatgaaagatggcaaagatctggaagtaactactgcaaggatggagattaaatca
acccttcacaaaactgctctcacagtcaaagattgtataagaattgacggagggcaatac
acacttcacctcagtaatgtaggcggtacaaaatctattcccataactgttaagatcctt
gataggcctggtcctcccgatggtattctgaaggtttctggtgttacagcagagaaatgc
tacttggcctggaacccaccttcccaagaaggcggtgcgaatatttcttactacatcatt
gaaaagagggaaaccagcagactgtcctggacacaagtggagactaacgtgcaagctatc
agtcacaaagtaaccaaacttcttccaggcaatgagtacatattccgtgtaatggctgtg
aataagtatggaataggtgaaccactggaatccgaaccggttgtggcgaaaaatccattc
cacgtaccaggtccaccaacaacacccgaagttacatcgatcactaaggactcaatggtt
gtaacctgggggcgtcctactgacaatggtggagctgagattgaaggatatgtactagaa
aaacgggacaaggatggaattaggtggaccaagtgcaataaaaagaggttgactgatttg
cgtttcagagtgactggtctggtagacggacacttctatgaattccgcgtatctgcagaa
aacgctgctggtgtaggcgacacgagtgaaccaagtattttctacagagcttgtgatgcc
atctatcctcctggtccaccaaacaatccaaaggtgacagacacgacaaggtcaacagta
tcacttgcatggggcaaacctatctatgatggcggagctcaaattagagggtattctgta
gaggttaaagaagctagtactgaagactggatcacttgcacgcctccaacaggggtgcag
tctacatactttacagtagagaaactgaaagagaatatcgaattcaatttccgtgtctgt
gccatcaactgtgaaggtgtcggtgaaccagcaaatgttgctgatacaattattgcagct
gataagttggagccaccagaaattgagctggacgctgatctccggaagattgtgtccgta
cgtgctagtggtactttgaggctgtttgttcccatcaaaggtagaccagaacctgaagca
aaatgggagaaagctgaaggaaatctcagtgaacgaacccagattgaagttacaagctct
tataccatgttggtccttgataatgtcaacaggtttcacagtggtaaatatcatttaact
ttggaaaataacagtggtactaaatctgcttttgttaacgtcagagttcttgatacacca
agtgcacctgtaaatctccatataagagagataaggaaagattgtgtgacattgtcatgg
gaaccccctcttattgatggtggagcaaagattaccaattacattgtagagaaacgtgaa
tccactagaaaggcttttgcttctgttaccaacaactgtactaaaacaacattcagagtt
gaatcacttcaagaaggaggtatttactgtttccgtgtcttggcagtcaatgagtatgga
acaggccttccagcagaaactgctgagcccattaaagcatctgaggtgcccttgcctcct
ggcaaagtaacattgatagatgtgacacgaaagactgcaactcttacctgggagaaacct
gaaaatgatggtgggagcaaaatatctagttatatcatcgaaatgcaaaccaaaggaagt
gaaaaatggacattgtgtgctcaagaaaaaacactggagacaaccgtcaaaggactaaca
gcgggcgaggaatacactttcagagtcattgctgtgaatgagaaaggaaagagtgatccg
agactgttgggagttccggtcgttgcaaaggatgttgaaattgaaccatccattgaactc
gcgttcaatagtttcagtgtgaaggctggtgatgacctcaaggttgacgtacctttcaga
ggaagaccattgcccactgtgacatggaagaaagacggacagtctttgaaacaaacaaca
cgagtgaatgttcagacatcaaagacgtctacacttatgaccattaaagaagcttcaaag
gaagatgttggaaaatacgaactaattgtttccaatagcacaggatcaataacctcctta
atcaatgttattgttcttgacaaaccagggccacctggcgaaatccgagtggacgatgtc
agtgctgataatatcactatatcttgggacccaccagagtacgatggtggttgtcaaatt
aacaattacatcgttgaaaagagagacactacaacaacaacttgggaaatggtgtctggt
actgtagccagaacatccataaaaattacacgacttaaaccagggagcgagtaccaattc
cgtgtctgcgcagaaaaccgttatggcaagagccacaataaggattctcacggtattgtt
gcacagtacccgtttaaaccacccggtcctccttcaactcccatcgtcgcacatgccact
aagaattacatgattgtgaagtggaacgaaccagtcgttgacggaggctccaagattctc
ggataccatgttgaacgcaaagaaagaagcagtatcttgtggacgaaggtgaacagaggt
cttgtgaccgacacgaagattaaagtcacttctcttgacgaagggctgttgtatgaatac
cgtgtgtatgcagagaacattgcaggtattggcaaatgcagtaaggtttgcgagcctgtt
gcggctagagacccatgcgaccctccaggtcaaccagaggtaacaaatattaccaggacc
tcagtttcactgtcttggactaaaccagaatatgatggtggtgctaaaatcactggttat
attgtggaaaacaaagagttgccagatggacgctggttgaagtgcaactttactaacatc
ccagaaacgtattttgatgttactggtcttactgaagatcaacgttacgagtttcacgtt
attgcaaagaattccgcaggtttattcagcgaagcatctgaatcaacaggtcccattact
gtgaaagatgatgtagaagcccccaggattatgttggatgctaaatttagggaaattgtt
attaaggctggagaattggttaaggtcaatgcagatattgcaggacgtcctcttccagtg
gtatcatggacaaaggacggtaaagagcttgaaggacaggcaaggactgaaatccagtca
actgacaagagtactataattatcgtgaaggactgcaataggcgagactcaggacagtat
gtcttaacactgcaaaacgttgctggaacaagatccttagcaattaacctcaaggtacta
gatcgaccaggcccacctgctggtcctttagacgtctctggtcttacagctgaaaagtgt
tcactgaaatgggcacctcctcaagagaacggaggagcagctattgatcattacattgta
gaaaggcgtgaaacaagtcgccttgcatggaccctggtaacagatgagttgagaacaaca
tcctgtaaagtaactaaactgctccgaggcaatgagtatattttcagagtgatgggagtt
aacaagtatggagttggtgaagttatagagagtgaaccaagaaaagcgcttgatccattc
acaattcctagtgcaccaaaatcattggaaattaccaacgtcacaaaggagaccatgacc
atctgctggtcaagacccgacagtgatggtggcaattcaattgctggctatatcattgag
aaacgtgagaagaatggactccgctgggtacgggtcaataagaaacctgtatacgatctg
agagtgaaggccacaggactccgtgaaagcgcagaatatgaatatcgcgtgtctgcggaa
aatgctgcaggtgtgggtcctgcaagcgaagcatcaacgttgattcgtgcagaagatcca
ctctttgtacctgctgctccatccaaacccaaagttgttgactctacaaaaacaagtatt
tcacttgcttggacaaagcccctatttgacggtggttcacctgtcactggatacactgta
cagtataaaaagtccgaagaaaccgaatggaccacagccatccaaaacctgagaggcaca
gaatttacagtaattggactcacatcaggagcagaatatgttttctgtttatcttccatc
aataaggttggggtcagcgatccaagtgaggtatctgagccacaagttgcaaaggaaagg
gaagaagagcctgctttcgatatcgacaatgaaatgcgcaaaactttgattgtcaaagct
ggcagctcctttacattagccgtgccgttcaaaggaaaaccaatacccaatgtcatgtgg
agcaaatccaatgtagatctccgtgtacgaggaagtattgatagtaaagatttaatgaca
tcattaaccatagaaaaagcaacaaggaacgactctggtaaatacgtattaacattacag
aacgtgttagctacggccacactgacattagttgtcaaggttctggactcccctggacct
cctggcgctattattccaaaggaagtcaccagggattcagtcctgctgacctgggatgta
ccggaaaacgatggcagtgctcgtgtgaagaattatcacattgaaaaacgtgaagctagt
aagaaggcttgggtctgtgtgacaatgaattgcaatcgcctcacttacaaagttaccaat
ctccaagagggggccatttactacttccgcatcaggggagaaaatgaatttggtgtcggc
gttccgattgagaccaaggaaggtgttaaagtgacagaaaagccaagtgtacctcaacga
cttggaattacaaatgtcaccaaagatagtgtgtctctcgcttggtccaagccagaacac
gatggaggcagtaggataaccggctactttattgaggctcttgaaaaaggccagcaaaag
tgggtcaaatgtgcagttgtgaagaccacacaccacattatcgaaggtttgagagagaat
ggtgaatacttcttcagagtatccgctcaaaatcaagccggcctcagcgatcctaaggaa
atggttctacctgtaaccgtgaaagaacagcttgattcacctgagattaatctgaagtac
ttcccgcacaacacagtgtacgtcagagctggatccaaccttaaattcgaaatcccaata
tctggtaaaccacagcccaaagtgtctttgtcgagagacggattggttgtgaagtcaacc
atgaggtttaacacggagatgagcgcagagagcctcattgtgaacctgagagaaagtgtg
gcgaatgacgccggtcgatacgatattactgctgccaactccagtggaacgaccaaatca
tttatcaatattgtggtcctcgacagacccagccccccattaggtcctgttaatatcagt
gacgtcaccgaagatagcgtcatattgaaatggcacccgccggcctacgacggtggcagt
caggtaaccaactacattgttctcaagcgagaaaccagtacggcagcctggtcagaagtg
tccgccactgcggccagaagtataatcaaagtcatgaaactgaccaccggagaagaatat
caattccgcatcaaagccgagaaccgatttggaatcagtgaccatattgattctgcatct
gtcatggtcaaactgccttacactacgcctggacctccatcgactccgtgggtaactcat
gtcaccagagagagcatatcagtgggctggcacgagccagtttccgatggtggcaaccaa
gtgattggatatcatttggaaatgaaagacagaaacagcattctatggcagaagactaac
aagactatcatacgtacgacacacatgaagatcactcatatcactggtggacttatctat
gaattccgggtgtatgcacaaaacgctgcaggcattggcaaagttagccatctttccgat
ccagttcttgcgattgatgcttgcgaacccccaacaaatgtacgtgcaacagatgttaca
aagaacgctgtaagcctcagctggaaaaaacctgcttacgatggtggtagcaagatcacc
ggctacattgttgaaaagcgcgatctgccgaatggacgatggacaaagggcagctttatt
aatgtcattgagactctattcagtgtctcaggtctgactgaagatgcacaatatgaattc
cgtgtatttgctaagaacgcaaatggttctataagcaatccatctgacgttcttggacct
gtaacatgccatgacacctatggtgctcctcagattgatctgccgatggaatatttggat
attgtcaaatataaggctgattctgctgtgaaacttaaagttggcatctctggcaagcct
ttcccatccattgaatggtacaagaatgaaaaagaacttgagactagtgctcaagtctct
attgaaagtacaactgaatcggcagcagtattaattaaggatgccagtcgtatcaacagt
ggaaactatgaaattaaacttaaaaattccatgggctcaggaacagcaacaattagagta
ctgatactagacaaacctggccctcctggaggtccgatagaattcaagactgtcacagcc
gagaaaatcactatcatgtggaaccctccagaggacgatggtggagcttctatcagccac
tatatcgttgaaaaacgcgagacaagccgagtcgcttggtctctcataacagacaagttg
gaaacttgtatgatttcaatgcagaaactcattaaaggcaatgaatatgtattccgtgtc
aggggtgtgaacaaatacggtgttggtgaaccactggaatctgatgttgttatcgctaag
aatgcatttgtgacacctggacaagccagcatgcccgaagccacaatgataactaaacag
acaatgactatcacctggacgaggcctaccgttgatggcggcaatgaaataattggttat
ttcttggaaaaacgagagaaaaggagtcttcgctggttcaaggtcattaaggaacccatc
cgtgacaccaggcaaaaggtctccggcctcaccgaagggaacgagtatcaattccgcgtg
agcgccatgaatgcagctggactcggcccaccttctgacatctccgatttctacaaagcc
gccgatccagttgatccaccgggcgaaccaaccaaactgaagattgtcgacactactaag
tcgtccatcactctgagctggactaaaccagtctacgatggaggaagtacgataacaagc
tacgttgttgaaaagaaggaagctgaggaagaggaatggacagtggtcagtgcaaagggt
gaagtcagaacttcagaatatgttgtggcccacttacaacctggtatcaactattacttc
cgggtcagtgccgtcaacattgctggccatggagagccaattgaaatgacagaacctgtg
caagctaaggacatacttgaagggccagagatcgatcttgacgttgtgatgagaagttca
ataacagtaaaagcaggcgaagacgtggagatcatgataccctttaaaggccgtcctact
ccaaatgtcacatggaggaagggtgagaaactgatcaacggggatgagaaatatatcatc
cacaacactgagtcaaccacattcatgactattcctcaggtcagtcgtgaggattcgggc
aaatacgtgttgacaattgaaaatggcgtcggtgaagccaaatcaacttttgtgactgta
aaggtccttgacactcccggggcttgtcagaatatacagatcaagcatgtaacccgaagc
accgtcacattaatctgggaccctcctcttgtaaatggcggttctgcaatttgtaattat
gtcatcgaaaaaagagatgcaacaaagagagcctggtcttgtgtcactaccaaatgctgt
ggaaccatgttcaaactgaccaacctgtcagaaaagacatctttctttttccgagtaatg
gcagagaatgagaacggattgggtgtcccatgtgagaccacggaagcagtgaaagccact
gaagtgccaggacccgtcaaagagctcgcaatgaaggattccacaaagacgtctgttgtg
ttacaatggaacaaacctgattatgatggaggaagtatcatctcagactacatcatcgaa
aagaaactgaaagaggagaccgaatggtccagtgctggaacttgcaaagtttgcgaattt
gaagccactaaattaaaggagctaacagctatggatttccgagtatttgctaaaaacgaa
aaaggactaagtgacagtgttacaatcggacccattacagtgaaagattatgttatcacg
cctgaagcagatttatctgaaattccaggaggacagattagtgtcagaattggacacaat
atccacattgaactgccttataagggcaaaccgcagccgagtatccaatggctgaaagat
aatgctccgttaaaagaaaccgagtttattcggtacaagaaaacagccaccaaagcgact
ttaaatatcaagaacgtcaagaaagaacacggtgggaaatacaccttaatcttggaaaat
gctgtttccagaaaatcgttcagcatcactgtttttactctgggtcctccatccaagccg
aagggaccagtcaaatttgatgaagtgaaagcggacagcgtcatcgtttcctgggatgtc
cctgatgataacggaggaagtgagatcacttgctacagcgttgaaaagcgtgaaacctcg
caaaccagctggaaaatggtttgctccagtgtcaccagaacaagctttaaggttccaaac
ctggtcaaagacttggagtaccagttcagaatccgagctgaaaatagatatggaataagt
gcgccacttaattcaatggatgttatcgcaaaacaccagttcagacctcctggtcctccc
ggcaagcctgttgtgtacaatattacctgcgatggtatgacaatcacgtgggacgcacca
gtatatgacggcggttccgaagtaattggttatcatgttgagaagaaggaaaggaacagc
atcttgtggcagaaggtcaacacagcatacatttctggcagagattatagaattatagga
ctcatcgagggtctggactaccagttccgtgtttatgctgaaaatagtgttggattaagt
ccagtcagtgaattgagtaaattacatctggctgtctcaccagttgatccacccggtaca
cccgattatatcgatctcacaagggatactgtaacacttaagtgggatgcaccactacgc
gatggtggaagtaagattgtcggctattgtgttgaaaaacgccaagcaagtggacgttgg
ctacggtgcaattttattgatgtttccgagtgtcagtatacagtctcaggtcttagccct
ggtgaccgatatgaattccgtataattgctagaaatgcagtaggaacaatgagcccacct
tctcagtcatccggatacatcatgaccagagatgaaagcatatcaccaacaattgaattt
ggtgctgagcactttgaaggcctgaccgtaaaatcgggtgaggcaattcgaatgaaggtg
catatcaaaggccgtccattaccccaggttacttggttcaaagatggaaaagaaattgac
aagaagttgatggtagacatcaccaatgttattggatctagcagtgtctttgtcagagac
gcctcacgggatcaccgtggtgtatacactgtggaagccaagaatgcatctggcagcaag
aaggctgatattactgtcagagttcaagataccccaggaaaaccaattggacctatccga
ttcagcaatattactggagaaaaactcacattgtggtgggaacctccagataatgacggc
tgtgccgtaattacccactatgtgattgagaaacgagagacgagccgaattgcttggtca
atggtcagtgataactgcgaagcctgctcattctcagttaccaaactaatcaagggcaac
gagtaccagttccgtatatccagtgtcaacaaatttggtgttggaagaccattagattct
gaaccagttattgcacagatacaatacaccacacctgatcccccaggaactccagaacca
acctatgtaacaggagacagtatcacagtgacttggtccagaccacgatctgacggagga
aatgaaatcaaacaatacatccttgagcgacgtgagaaaaagagcatgcggtgggtcaaa
gtgtttagcaagagaaccatcacagaaaccagatatagaataactggactcactgaaggg
aacgaatacgagttccgtgtcacggctgaaaatgatgctggagtcggaccctcaagcgaa
atctcaagacttgttaaatgcagagaaccagttaatccaccaggtgcgcctacagttgtc
agagtcacagacacaacaaagacatccgtgagcttggaatggaccaagcctgtgtttgac
ggaggcatgccgatcatcgggtacatcattgagatgtgcaagaccgctcttggcaattgg
aataaggtgaacgcagaggcgtgtgtcaacaccaaatacaccgttactgagttggaagct
acggaagagtacacattccgtgtctgtgccgtcaatagtgcaggcaaaggagatagctgt
gaggtagcctccgcagtgcaagctgtagataggttaacgtcacctgaaattgatattgat
gccagtttcaagcaaatccacattgtcaaagctggaggcacagttcaactcagcattgct
ttccaaggcagaccagtacctgttgttacttggtccaaggcagattcatccattgggata
cacgctcacattaacacaactgacacattcagcgttttaacaatagaaaactgcaatagg
tacgatgctggtaaatacacacttagtttggagaacaatagcggcagcaaatctattaca
ttcacagtcaaggtactagacactccgggagctccgggcccaatcaccttcaaagacgtt
acaagaggatcagtgacattgatgtgggatgctccagttattgatggaggttcaagcatt
cgccattacattatagaaaagcacgaagctagtcggcgtagctggcaagaaattagtgga
aagtgttcccgacagatcttaaagataggagaccttgctgaaggggtgcaatactacttc
cgcgtcatggcagtaaacgaatatggcgtcggcgagccttatgaaatggcagaacctatc
attgccacagaggaaccggcaccaccgaagagactggatattgttgacactggcaagacc
tctgctgacttggcttggatgaaaccagagcacgatggtggtagtcgaattactggttac
ctgatacagatgaagcagaagggttcagatcactgggttgatgcctgtaacaccaaactt
cttcaggttacagttgatggacttgtagaaaacacagagtatgaattccgtgtccaagcc
aagaacgatgctggttacagtgaaccaagagagtccttttcatctgttattattaaagaa
ccacggatagagcctaaagcggatctcactggcatcaccaatcaaacgatcacttgcaaa
agcggaagttcctttaccatcgatgttcctatcagtggacgtccaccacccaaggtaact
tggaaactcgaggagatgagacttaaagaaactgatagagtcagcatcaagacaacaaaa
gagagaaccactctgtgcatgaaggaaagtctgagaggcgactctggcaaatattactta
acactggaaaacacagcaggagtcaagacttttaccgtgactgttaatgttattggccga
ccaggttctgttactggccccatagaaatctcatcagtttctgcggagtcctgcgtattg
tcatggcaagagaccgaagatgatggtggcgcagaaatcaccaactacattgtagaaaaa
cgtgaatctggtactacagtctggcagctggtcaactccagtgtgaaacgcactcaaatt
aaagtcacccgtttgacaaaatacatggagtacaacttccgtgtctctgcagagaacaga
tttggtgtcagcaaaccgttagaatcagctcctatagtcgctgagcatccatttgttcca
ccaagtgcaccaactaggccagatgtctactttgtttcttcgagtgccatgtctgttcga
tgggaagaaccataccatgatggtggtagcaaagtcaatgcctattggattgaaaagaag
gaacgcaacagcattctttgggtgaaggaaaacaaaataccatgcatcgagtgtcactac
aaaatatccagcctagtagaaggcttggagtaccagttcagaatctatgccatgaataaa
gctggcttaagcaaagccagtgaagcatccagaccacaaatcgctcaaaatcctgttgat
cctccaggtcgacctgaagttacagatgttgacaattcatctgtttcgctgaaatggaca
gtgccaatcaacgatggcggaagcaagattgttggttatgttgtggagcgtaagccatat
tctgagactggcgaaggtcgctggctgaagtgcaactacacttctatcacagataccttc
tacacagtgtcagggctcagtgaagcagaggtttatgaattccgtgctttagctaagaat
gcaagtggagtcatcagtataccatctgaatccactggaccggtcacttgcagagatgaa
tatataccaccaaaggctgaactacacaccagactgcttggagaagtggtaaccataaga
gctggctcagatcttgtacttgatgcgtttgttggtgggaaacctgatcctaaggtcttc
tggtctaagggagacaaagaactggagctttgtgaaaagatttctctgcagtacactaac
aagcgggccatcgccatcattaagttctgcgacagaagtgacactggaaaatacacacta
actgtgagaaatccaagtggaattaagaccgtatctgtaaatgttaaagtgctcgattca
ccagggccttgtgaaggttcaatcaccatcagcagagtcactgaggaaaaatgcactttg
acatggaatatgccactagaagatggtggagccgagattacacactttattgtggagcga
cgtgagaccagcagacttaactgggcaattgttgaacctgagtgcctcactctttccact
gttgcttcgagatttgtaaagaacaatgaatacattttcagagtaagagcagtcaacaaa
tatggacccggtgtactgctcgagtctggacctgtagtggccagaaacctattcactgtt
ccatcacaacctggggagccacagtttgttgcagttggtaaagaacatatcatcatccaa
tggatgaagtgcgaaactgatggcggagctgaaattagaaactacctggtagataagcgt
gaaaaacgaagtgtgcgctggacacgggtcaacagagattatactgtttatgacactaga
ctcaaagtgacaggtttaatggaaaattgtgagtaccaattccgtgtttcagcggtgaac
gcagctggcaacagtgaaccaagtgaatcgtcacagtacatcctttgcaaagaacctaca
tatacacctggattaccttcagcgccaagagttgtggacacaacccggcacagcattagc
ctagcatggacaagacccatgtacgatggtggttctgatatcatcggctatgtacttgaa
atgaaagaggaaggtacagagcagtggtacagagcacacacgacttcttccctaaggaac
actgagcacacgattgcatcccttgtaactggcaagaagtacttcttcagagtggcttct
gtcaatatcaacggaataagtgaattcagtgaatcatctgctgaaatcgaaacagttgaa
aggatagcaatcccagaccttgagcttgatgatgacctgaagaaaactgtcactgttaga
gctggtggctctctccgcttaatggtctctgtatcgggaagaccagctccaataataaac
tggagcaagtctggtgtcgatctcatgagccgtggtttcattgatacaaccgattcttac
tcactgctaataatcgacaaagtgaatcgttacgatgcgggaaaatacatcattgaggct
gaaaacccatctggcaagaaagcagcaactattgttgtcaaagtatacgatacacctggc
ccacctggtgtggttaaggttaaggaagtcacaaaggattctgtggttttaacttgggaa
gtgccattaatcgatggtggagcacctatcaataactatatcattgagaaacgtgaagca
gctatgagagcattcaagacagtgacaattaagtgcaacaagacaatttacagaataacc
ggactccacgaaggaagcatgtactatttcagagtcttgccagagaatatctatggaatt
ggtgaaccatgtgaagtagcagattctgtgcttgtgtctgaagttgctatggttccacag
aaactagaagtgattgatgtcaccaagacctcagttacactagcctgggagaaaccacta
catgatggaggctctagattgactggttatgtaattgaagcgtgcaaggccggtacagac
agatggatgaaggttgccaccgttaaacagacggtcttccagcacaccatcatctctcta
aatgagaacgagcaatacctcttcagagtccacgccctaaatgcgaagggtatgagtgaa
gccagagagattgtgactgctgtcactgtaaaggaacagaaagtggtgccaacgatagat
ttagtgggcataactcaaaagaccgtttcagtgcacgctggcaagcccattgagctggtt
attccgatcggtggccgtccatatcccgcggcttcctggtactttgctggaaacaaaatg
agagagggcgatcggatcaagatggaaaaatcagctaaagtagtgaagcttaccgtgcgt
gaaaccactatcagtgacaccggtgactacatgcttgagctgaaaaacactgctggaacc
actactgaatctatcaaagtgatcatccttgacaagccagggtaccccacaggtccaatt
cgatttgatgagattgatgccacctctgtgactatcagctgggacccaccagagaaagaa
ggtggagcgaccatcactggctatgtggttgaacaacgtgatgctcatcgcccaggatgg
ctgccagtgtctgaatctgttacaaggaccatgttcaaattcattagattaattgaaggc
actgaatacgtcttccgtgtagcagctacaaaccgctttggcatcggatcattcttacaa
tccgacattgtacagtgcaagagtgcgatcgacacctctgaacctcctgatacgccccag
gtattcgatatttctcgtgatggaatgaccattacttgggatgtgccagttgaagatggt
ggctcccaggttaccgggtacatcattgaacgcaaagaactgagagctgaacggtgggtc
cgagtcaacaaagtacctgtgactatgacaaggtaccgttccactggactcattgaagga
ctagagtatgaacaccgagtgactgctatcaacgcaagaggtgaaagcaaaccaagtcgg
ccaaccaagcctgcaattgccatggacccaatagaaccacccgaaaagccccagaaccca
agagttacagacaccacacgaacatccgtgtctcttgcttggaacccaccggaagaagaa
ggaggttccaaggtcaccgggtacctcattcagatgcagaaaatcgatcagtttgaatgg
accaagtgcaataccactccaacaaagatctgtgaatacactctgactcacatgccacag
ggagctgaatacaggttcaggatattagcagttaatgctggtggatctggtgaacctgct
gatgtcccaggaacagtcaaagtcactgaaatgatagcatatcctgattatgaacttgat
cctaaatatatggaaggcctactggtcagacaaggtggagtcatcaggctgactgtgcca
atcaaaggcaaacctattcctgtttgtaagtggacgaaggaaggtcgtgatgtcagccac
cgtgctatgattgcgtccagtgacaccgacactgaacttgtgataaaagaagcagataga
gaagattcaggcacttatgacctggtccttgaaaacaaatgtggcaaaaaggcagcttac
attaaggtgaaagtgattggaatcccgaatcgtccggaaggaccacttgaatttgatgac
atacaagctcgttctgtcagagttagctggagacctcccactgatgatggtggatcggac
atcattgcgtatattgttgagagacgtgaggtgcccaaaactgcctggtacactgttgat
tgcacagtaaaggagtgttccattgttgtgagaggcctgaaagaaaacatagaatatcac
ttccgagtttctgctgaaaataactttggcatcagtcaatctctaaaatctgaggagcca
gttataccaaagacacaactaaatccaccagagcctccaagcaaccctccagaaatcctg
gatgttacgaaaacgtccgtctctctatcctgggcaaggccaaaggatgatggtggatct
cgcgtcactggctattttattgatcgcaaagaatctactacagataaatgggttcgacaa
aacaagacccaaattactacaacaatgtacacggtcacaggacttgtaccggatgctgaa
tatcagttccgtatcattgcacagaatgacataggatccagtgaaccaagtcaagcatca
gatagtgttatatgcaaggatccctttgataaaccaagccaacctggagaaatcgagatc
atttctgtcacaaaggatagcatcgctattaaatgggagcgtcctgaatgtgacggtggc
aaggatatcattggttactggattgagtaccgtcaatctggcgatagtgcctggaagaaa
tgcaacaaggaccgcaccaaagacagacagtttacacagggaggccttctggagtctacg
gagtatgaattcagagtctttgccgagaatgagaccggaatcggcaggcctcgtagaact
cctgtagcaatcaagaccaaactaacatctggagaagcaccagcagttagacaagaagta
aaagatgttacagctaaattgggtgagacagcaacactgagctgccagataattggtaaa
ccacttcccgacatcaaatggtaccattataccaaagaactaattcaaagccgcaagtat
aaaatgagctcagacggacgtaaccattcattaactgttaaaacagaagatcaggaggat
gaaggttcgtacacctgcaaggccaccaatgacgcaggggagactgagcttactggcaaa
ctcttgctccaagcagctccaatgttccactctggattcccattgaaagaaaagtatata
gttggcagtggcacaagtctccgcatccacgtggtatacattggtcgtcctgtgcctgct
attcactggttccacggcaagaaaccgttagcagtttcagagactgtattgatagaaaac
acagaaaactacactcacctcgtgatcagaaacgtccaacggaaaatccatgctggaaaa
tacaaagtgcaacttagcaacgtgtttggaacagtggatactatacttaatgtggaaata
caaggtaaaccagatatgcctgaagggccaatagtaatggatgctttcctgaagaattcg
gcagtgatcagctggaaaccaccaattgataacggaggagctatgatcaccaattacatt
gtagaaaagcgtgaagccaaagaaggagaaacatggaagcttgtatcatctgctatcgct
ggcacatcttgcagaatcgtaaaccttatcgataatgctggatactacttccgtgtttct
gctcaaaaccagtttggtgtcagtcaggcattggaagtctcagccattgtcatcatcaag
agtgcatttgggaagcctggtgtaccgtccaaacctactgtagccgctgtcacaaaggac
tcttgtgtggtatcatggaagccacccactagtgatggtggtgcaaagattagaaactac
taccttgagaagcgcgagaagaagcagaacaaatggatcgccgccacaaccgatgaaatc
cgtgagaccgtttactctgcggaaggcctcatcgagggcctggagtatgagttccgcgtc
aagtgtgaaaaccttggcggtgagagtgactggagcgaggtatccgagcccatcattcca
aagtctgacgtgcccattagagcaccgcagttcaaagaagaattacgcaacctgaatata
aaatataagggcaatgccacttttgtttgcaagattactggaaatcctaaaccgatcgtg
aaatggtttaaacaaggcaaagagatcgagcctgatggtgtaaagttaaagatccaggaa
ttcaagggtggctaccaccaactggtgattacaggcgtcacaggagaagatgctactgtt
taccaagtccgcgcaaccaaccaaggaggtgctatttcaaccacagtctcattggatgtt
gaagttcctgccgagattcacttacccaaacatctggaaggcatgggtgcagtccacgct
ctccgtggtgaagtaattagcattaaaattcctttctccggcaagcctgatcctgtaatc
acatggcaaaagggacaagatctgatcgatactaacggtcactttcaagtcattgtgacc
aggtcattcacctctctcgtattccccaatggagttgacaggaaagatgctggtttctac
attgtatgtgccaagaacaggtttggtatagatcagcaaactgttgaactagatgtggca
gatgtacctgactcgccaagaggaatccaggtcagcgacatctcacgtgattctgttgct
ttaacatggaatgctccagctagtgatggtggaagcaaagtaattaactacgttattcaa
aagtgcgcaaccacggcggaaatgtggattcgtgttggacaatcacgtgatacgcattac
acggttgtgaatctgtttggcaagaccagctaccagttccgggtcatagctgagaacaag
tttggtcagagtcaaccatcggaatcaactgaacctgtcgtcactaaagaagacaagacc
agagttataaactatgacgatgaggttgatgaactgagagagataactaaacagaaagct
actcactctgctaccaaagaacttcacaccaaatacatgattgctgaagagctaggacgc
ggacagtttggtattgtgcaccgatgcatcaaacacagcagtaagaagacgtatatggca
aagtttgttaaagtaaaaggcgctgatcaggtattggtgaagaaggagattaatgtcttc
aatgttgctcgacaccggagcatccttcagctgcacgaatcatttgatagtcttgaagaa
ctggtcatgatctttgagttcatctcaggcgttgatatctttgagcgcatttgctcaact
acttttgagttgactgaaagggaaattatcaactacactcgccagatctgcgaaggactt
gagttcctgcatagtcagaatataggccattttgatatcaaagcagagaatgtcatttac
acaacgagaaagagttccaatattaagattattgaatttggacagacgagacaacttaaa
cccggtgataacattaggatacagttcactaccccagaatacacagcacctgagctgcat
cagcacgatatggtcagtacatccgttgacatgtggtcagtaggtactcttgtctacata
cttctttgtggcctcaatccatttatggctgagacaaaccagcaggttattgacaacatt
tgcaacgcagaatacaactttgaggacgaagctttcaaagaagtctcaactgaagctcta
gacttcgtagatcgcctcctggtcaaagataggaaggcccgcatgactgctgctgacgcc
ctcgaacatccttggttgaaacagaggacagagagaatgagcaccaaagtgattaagact
ttgagacacagaagatactatcagagcataatgaagaaagatttaaatgtcgtcgtctct
tctgctcgtatatcttccggtggggctattagatcacaacgtggagttactgttgccaaa
gttaaggtggctccaatcgatatcggtcctcttacttcccaaattatgcatgccactgct
gaagaaggcggacatgtcaaatattcctgccggatagaaaactatgatgagtctactcaa
gtgacttggtactttggtattaggcaactggaaagcagcagcaaatatgaaatttcctac
caagatggtttggcatcgatgtatgttaaagacatcaacggtgcagatgatggcacttac
cgatgcaaagtacagaacgactatggtgaagatagctcctacgcagaactgtttgtgagt
ggtgtcagagaaatgcgttcctattatgttcgccgtaaggtcaggaaagcaaaacgcaga
gtggataccatgaggctccttgagaagccaccagagtttactttgcctctgtacaatcac
tctgcgtacatcggagaaactgtcagattcggcgtcaccataactgttcaccctgaacca
cgtgtaacgtggttgaaatttggccagaagattaaaccaggcgaggatgagaaaaagtat
acttttataactgacaaaggcctctaccagcttctaatccacaatgtaacattagatgat
gatgctgaatacactgtgttagctcggaataaatacggtgaggatagctgcaaaggcaga
ctgacgataacgcctcacccacctccagcagacaacactttaagaccaatgtttaagcgt
ttgttggcgaatttagaatgcgtagaaggcaactccgttcgttttgaatgcagagtgtct
ggcacaccacctccgactctgaagtgggagaaggatggtcaacctttgcctttttgtcca
aatattgaagttatccatgaaggtctagactactatgtcttgtgcattagggacacatta
gcagaagactcaggcgtttacagagttattgcaaccaacagtgccggatctacaagttgt
caagcctacctaaaagttgagcgtgtgacctatgtcaagcatcagtataggaacgaggag
gaccgtaaacagcaggttcagaagaaaattgacaaaaccttgcgaatggctgaaatactg
gcaaaggttgaacatgtgtcattgacatcagtagcacaggaagctctgagagaagctgct
atactgtataaaccagctgtcagcacaaagaacgtacaaggagaatatgaaatatcaaag
gaagaaaaggtaaaggcagaaaagaaactgcgcatgccatatgacataccacaacctcgt
gtgcatgaagcgagggcaatcgaagaagatcaggatatcaaacaatttgtgcctttgtct
gatatgaagtggtacaggaagatacgagaccagtatgaaatgccaggaccgatcgagaaa
cttgtgacaaagagacccaaacgaatccgtctctcgagatgggaacagttctatgaggtg
cctttaccacgctttacagatcagtacaagcccaagtggcgcataccaacatcgtcccaa
gacgatctggaaatagtcagaccggctcgaagacgctcactatcgtccgagtgtgaaata
tgttgtaggccaagaaggagatcacttggcgatgtttcagttgatgaattgcttctcccg
gtcgatgactacctttcaatgaagagagtagaagaggaacgactacgcctcgaggaggaa
cttgtgttaggattttctgcttcccctccacggtacagccctcagcgttttgaattatcg
tcacttcagcacaaatctttacggacacaactagctacagaggaggaggaggaagattat
cgcaagtacaaaacatatcatatcccttccaaacatgaagctggcacaagctttattgac
ctccgccaacgtcacgacaaggctgtttataagccaccaaaacaaaagcaaaggttaatc
gacgacagagaggacgaagagctgcttcgaccgtatcgcatgaccgagagattgacctcc
tacaaaaaggaacttgagcacatggaacacgaggagaagcataggttcacaagtagacga
gaagtggggattgtacaggcacaagtaggcgaggaagaagaagtaatggaagtcaagaaa
tacgtccgtagggaatctccctccgtctcgaagttcctgaggagaaggcgatcactttcc
ccaacttacatggaactgatgcgaccggtgtctgaactgattaggtctcgacctcgccga
ccagctgagagactggactcggagagtgaaggctcggaaaggcgctcacctaccccagag
agaacccggccccgttcacccagtcccgtctccagagaaagttcactctcacgttttgaa
aggaccgcgcggttcgacattttttccagatacgaatcaatgaaatctgcgctaaaaact
cagaaaacaacagaaagaaaatatgaagtcgtcacccaacagcccttctccctcgaccac
ggaccgcgcatcacgttgaggatgcgttctcaccgcgtcccagtcggccagacgaccaga
tttactttaaacattctgtccaaaccaagatctgaagtgaagtggtatcacaacggcaaa
gagattcaagagggcgagaaatataagtttaccgatatgtctggcgtgctgaccctggag
attgtcaattgccaagctgatgacagtggcacttaccgcgctgtttgctccaattacaaa
ggagaagcctctgattacgcaaccctagatgttactggagggggctactcttcctacgtg
tctcgtcgtagggatgaagaaccaccaaaaccatttatgcctgacatgacccgaaccgat
atttaccatctctccaccattaagcaagcaaccacaaccgaaagttcttctgaactcaga
ggattcaaatcggaagaatcccaaagaagggaggcagtcagctcggaaggttatgccttc
gaagagaaaaaattaaggacagaggaaataagagcaagaacagaggaaagcaaaacaagt
gaagaaagatccactcggacgtcaacaaagctgactgtccaagcaagaatactgacaaaa
ccgcaatcagccacagtagcagaaggagaatctgtgagatttgtttgcgactttgatggt
gagccagcacccactgtgacatggaaacatgctggaacaacaatttcatcctccaggcga
caccttattacatcaacgcaattcaaatctacctttgcaatctcgtcagttcaatcttcc
gatgaaggaagctacacggtggtggttgaaaatgctgcaggaagacaggaagcacagttt
actgtaaccatccgaaaagctgtagcaaagggaatgggtgtggtatcacctccgagaatt
aagtcccctgaacctcatggaaaaccatcatcggcaagtaagtcagccaagagagtcaaa
tccccagaccaagccagctctggctcaagagttaagtcgcctcctcctgtccgaacagct
tcagcagagcgagtggaaatccctgcatccactccacccaagatttctcaaggattaaaa
gctgaaatacacgaagacggtgcagttaaactgacctgtacggtggagagcactgtcctc
aatgtcaaagaattgacttggctgaaagatggccgtaagatacgggagaacagtcactac
aaatttgaatattctgccgacggcgtctataacctcaccatccacgggcttaacgagagc
gatgaaggggaatacacatgtgaaatcaccggggagggaggggtttcaaaaacagctttc
tctttcgtcggtcaagccttcaaaagcgcagtcagcaaagtggccaaaatcacagaatca
aaggcagctgtgcagaaaaaagaagtgatctcaaagccgattatcaccatgtacctcagc
gacctgtctgtagcctctgataccatggcaaggctgactgtcaaacttgcaggagaacct
aaaccaactgtaacatggaccaaggatggcctgactcttgctcagagcagcaaatataaa
atatttgaagaacacggtagcttttgccttgaagtcctccacactgagacatctgactgc
ggagtttacggatgtactgctagaaattcagctggctcagcatccacaagctgcaaagtg
acagtaaaagcttccaaaagctccaccgatagcctgcgagttgaatcacagagaaaaagt
tcgattaaagcacatgaaacagcagtcgtcgaggaacagattgtcaaacaagcattaacg
cttgaagaggtcaaaacatcatacacagaaattaaagcctccaagatgcacatgaatgca
gaaaatggccagaaggttatacttaaggccagcataccgcaggctgccaatgtgaaatgg
atcttgaacggtactgagcttaggaactccgaggattaccgatatggtgtgtctggaagc
gaccacaccttaaccatcaaaacagtcagtttcgcagacgaaggaataatcacttgtgag
gctaaaactgaacacggagtagtaaaatgccaatttgatctaatagtgaaacatagtcaa
tcaaatgccccgtcattcgttgcacaacccaaatcccaaaatgttaacgaaggacaaaat
gtgtctttcaattgcgaagtatcaggagacccttctccagaggtagagtggctgaaagac
aaccacgctattgcgatcacaagaaatatgaaagtgagccgttctaaaagcaaatacaca
ctagaaattctgaacacaacagtctctgacagtggaaagtatacagtgacagcaaagaat
ttccatggacagtgttctgcaacagcatctttgaatgtgctcgctctgattgaagaaccc
gctaaaatggttgttctggagacgagtgcttctgctagcatgcaggaacggttctcttcc
aagacagtccaaatgagcaaacaggaagccagcagcagcatgtcggaagttaaatttgcc
agcatgtcttccagtagcatgtcatctatgaaagaatcaatgttatccatgagctcaagc
tcttttatggggcacgcaagtatgagtcaactcgaagcaactgcaggaaaaatgataact
ggttgcatcaaagggtcttctcctaaaattgaagctctcccatcagatatcaccgttgag
aaagggaaggttctaacagtggcgtgtgccttctcaggtgaacctacaccagacgtaaat
tggacctgtgggggaagatctctttctagtgaaggagtgggtggccgattccatcttgaa
acactggatgacctgacaacactcataatcacaggtgttaaagaaagtgatgcaggacat
tacactctcaaactcacaaatgaatttggatcagattctgccactgtaaatattgaagtt
agatcaatttaa

DBGET integrated database retrieval system