KEGG   Callorhinchus milii (elephant shark): 103176734Help
Entry
103176734         CDS       T03088                                 

Gene name
oxtr
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04020  Calcium signaling pathway
cmk04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103176734 (oxtr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103176734 (oxtr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cmk04030]
    103176734 (oxtr)
G protein-coupled receptors [BR:cmk04030]
 Rhodopsin family
  Peptide
   Oxytocin
    103176734 (oxtr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 103176734
NCBI-ProteinID: NP_001279135
UniProt: H3K0J0
Position
Un
AA seq 391 aa AA seqDB search
MNKTCCNNVDMDLCVPNASANGSALLENWSRFCNSSADLLKRNETVAKVEVTLLAVILIL
ALTGNIAVLLAIHSNRHKPSRMYFFVKHLSIADLVVAVFQVLPQLIWEITFRFHGPDFLC
RIVKYLQIVGMFASTYLLIVMSIDRCLTICQPLKSLHQRSNSMYVISSWVISLAFSIPQI
FIFSFREVGPEVYDCWADFIQPWGAKAYITWITVSVYIIPVLILTVCYGLISFKIWQNVK
LKTRRETKTPQGGSMLARVSSIKIISRAKIRTVKMTFVIVLAYIICWTPFFYVQMWTAWD
PHAPKEDLPFVLAMLLASLNSCCNPWIYMFFTGRLFQDLMHRFLCCSLLLAKPEPASGEI
TYSKKSNSSTFALSLKSSGSQKSIAVQQQQE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacgtgctgcaacaatgtggacatggacctctgcgtcccaaacgcctcggcc
aacggctctgctctgctggaaaactggagccgcttttgcaacagctccgccgacctgttg
aagcggaacgagacggtggccaaggtggaggtgacgctgctggcggtgatcctgatcctg
gccttgacgggcaacatcgcagtgcttttggccatccattccaatcgccacaagccgtcg
cgcatgtacttcttcgtcaagcacctgagcatcgctgacctggtggtggctgtctttcaa
gtcctgccccagctcatctgggagatcaccttcaggttccatggaccggatttcctctgt
aggattgtcaaatacctccaaattgtcggcatgtttgcctccacttacctgctgattgtc
atgtccatcgacaggtgcctgactatctgtcagcccctgaagtccttacatcaacggtcg
aacagcatgtatgtcatctcctcctgggtgatcagtcttgcgttcagcatcccccaaatc
ttcatcttctcttttagggaagtggggcctgaggtgtacgattgctgggcggatttcatt
cagccctggggagccaaagcttacattacctggatcaccgtctcggtctacatcatcccg
gtgctgatcctgacggtttgctacgggctgatcagcttcaagatctggcagaatgtgaag
ctgaagacgaggagggaaactaagacaccacaggggggttccatgctggccagagtcagc
agcatcaaaatcatctcccgagccaaaatcaggaccgtcaagatgacattcgttatagtc
ctggcttatatcatctgctggacaccttttttctacgtgcagatgtggacagcctgggac
ccgcatgcacccaaagaagatttgccattcgtcctggccatgttgctcgcgagcctgaac
agttgctgcaacccctggatctacatgttcttcactggacgtctcttccaggacctgatg
caccgttttctctgctgttccctgttgctcgctaagccggagcccgccagtggcgagatc
acctacagcaagaagagcaactcgtccacctttgctctcagcctcaagagctctgggagt
cagaagagcatcgcagtgcaacaacagcaagagtaa

DBGET integrated database retrieval system