KEGG   Callorhinchus milii (elephant shark): 103177390Help
Entry
103177390         CDS       T03088                                 

Definition
(RefSeq) soluble guanylate cyclase 88E-like
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00230  Purine metabolism
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103177390
Enzymes [BR:cmk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     103177390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA Guanylate_cyc HNOB KLRAQ FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 103177390
NCBI-ProteinID: XP_007889712
Position
Un
AA seq 676 aa AA seqDB search
MAKQVLGRHVRDFVNGLDNLHEYLRFSYPKVQPPTFFCQEESATGVTLHYRSKRKGYLHY
AMGQLRQMGKQFYQTDILVEVLSEQLVGDYSHVTMRLNFDNSAYRYIQKEDTERQEILPI
TSDFFFDVFPFNIVFRQDMVVHNVGSGLGTVFPDVDGKKINDAFLLARPLVEFTWNMIIS
HPNNLFEIMSKEPVKRERNLHNRIQNTDYESTNRTADVNVELMAFQSIVDDDHKDGNCAN
GMESWGDGTRCLKLKGQMRYMPEWESIIFLGTPVMESLGAMFKTGLYINDLSMHDSSRDL
VLAGTQQSEELKRALIQEQKKSSKLEESMKMLDYEMKKTDDLLYRMIPKPVAKSLRKGEP
SVNTCEVFPDVTLLFSDVVGFTRICSHITPMQVVSMLNTMYTVFDTLSEKHQVFKVETIG
DAYMVVAGAPEKTKYHAHNICDMALDMVRSIDHLKDPSTGNNIQIRVGVHSGMVVAGVVG
HRMPRYGLYGDTVHTASAMESNGKEMHIQLSGATYEHLQGSQFIFERRGSITIKGNVDIE
TYWLKGKRDKDGNAQATCLQFDTQTNSKTGPAPTSPNQDTPLIKPSDLQVKEEQVKPPSS
NQSKMNTSVNSLVESIEDGSVEDESLSKIQCKESFLESVLKDITYPLDSSHLPGTCTQLA
TASQSGPVMSQLCLLF
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacaagtattgggccgtcacgtgcgtgactttgtgaatggactggacaacctg
cacgaatatctgcggttcagctaccccaaggtgcagcccccaacatttttctgccaggaa
gagtctgctactggtgtcacccttcactacaggagcaagcggaagggatacttgcactac
gccatgggacagctcaggcaaatggggaagcagttctaccaaaccgatatcctcgtggaa
gtattgtctgagcagttggttggcgattactctcacgttaccatgaggttgaactttgat
aactctgcatatcgctacattcagaaggaggacacagagcgacaagagatcctgccaatc
accagtgacttcttctttgatgtttttccctttaacattgtcttcagacaggacatggtc
gttcacaacgttggctcagggttgggaacagtgttcccagatgtggatgggaagaagatt
aatgatgcttttttgctggcaagacctttggtagaatttacttggaatatgatcatttca
catcccaacaatctgtttgaaatcatgtcaaaggaaccagtgaagagagaacggaattta
cacaacagaatccagaacacagactacgagagcactaatcgaactgccgacgtcaatgtg
gagctcatggcatttcaatccattgtagatgatgatcacaaagatggaaactgtgcaaat
ggaatggaaagttggggggacggcacccgatgcctgaaactgaagggacagatgagatac
atgccagagtgggagtcaatcattttcctgggaactccagtgatggagagccttggagca
atgtttaagacgggtttgtacatcaatgaccttagtatgcacgactccagccgtgacctg
gtgctggctggtacccagcaatctgaggagctaaaacgagcactaatccaggagcagaag
aagtccagcaagttggaggagagcatgaagatgctagattacgagatgaagaagacagat
gatcttttgtatcggatgattccaaagccagtggctaagagcctgagaaaaggagagcct
tctgtcaacacctgtgaggttttcccagatgtgactctccttttcagtgatgtggtggga
tttactcggatctgcagccatataaccccgatgcaggtggtgtccatgttgaacaccatg
tatacagtattcgacacacttagtgagaagcaccaagtctttaaggtggagactatcggt
gatgcatatatggtggtggcaggggcacctgagaaaactaaatatcacgctcataatatc
tgtgacatggcgcttgacatggtccggtccatcgaccacttaaaggatccatccacaggc
aacaatattcagatccgtgttggagtgcactcaggaatggtagtggctggcgtggtggga
caccggatgccacgatatgggctgtatggagacactgttcacacagcttcagccatggag
agtaatggcaaggagatgcacattcagctgagtggtgccacatatgagcatcttcaaggc
agtcagttcatcttcgagcgaagaggctcaatcactatcaagggaaatgttgatattgag
acgtactggctgaaggggaaaagggacaaggatgggaatgctcaggcaacatgtctacag
tttgacactcaaacaaacagcaaaacaggaccggctccaacatcacccaaccaggacacg
ccattgataaaaccatctgatctacaagtgaaggaagaacaagtgaaacctccatcttcc
aatcaaagtaaaatgaacacatcagtgaattcactggtggaatcgattgaggacggcagc
gttgaggatgagtcattatcaaagatccagtgtaaggagtcattcttggagagtgtgctg
aaggatatcacctatccattggactcctcgcacctaccaggcacctgcacacaacttgca
accgcctcgcaatcaggtcctgtcatgagccagctctgcctcctgttctag

DBGET integrated database retrieval system