KEGG   Callorhinchus milii (elephant shark): 103177541Help
Entry
103177541         CDS       T03088                                 

Gene name
sucla2
Definition
(RefSeq) succinate-CoA ligase ADP-forming beta subunit
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00020  Citrate cycle (TCA cycle)
cmk00640  Propanoate metabolism
cmk01100  Metabolic pathways
cmk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103177541 (sucla2)
   00640 Propanoate metabolism
    103177541 (sucla2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103177541 (sucla2)
Enzymes [BR:cmk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     103177541 (sucla2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     103177541 (sucla2)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103177541 (sucla2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ParBc
Motif
Other DBs
NCBI-GeneID: 103177541
NCBI-ProteinID: XP_007889952
UniProt: V9KK05
Position
Un
AA seq 470 aa AA seqDB search
MAAAAALGCRFSAALTGDCMGVGVRRARATVRHGAQVFGAASGMLSVHGFQHNQQQRRNL
SLHEYLSMGLLKDAGISVPKGQAVRTPEEAYAVAKAFGSKDLVVKAQVLAGGRGKGVFES
GLKGGVKIVYSPEEARDTSSKMIGKKLYTKQTGEKGRICNQVFVCERRYPRREYYFAITL
ERSFQGPVLIGSSQGGVNIEDVAAENPEAIVKEPIDIIEGIKRAQAVKIAQKMGFPANVI
EDAADNMIKLYEVFIKYDASMIEINPMVEDANGNVMCIDAKINFDSNAAFRQKEIFALQD
WSQEDERERTAAQANLNYIGLDGTIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGAT
AQQVKEAFKLITSNKKVLAILVNIFGGIMRCDIIAQGIIMAVKDLELKIPIVVRLQGSKV
DDAKALIASSTLKILGCDDLDEAAKMVVKLSEIVSLAMEAQVDVKFELPI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcggcggcgctcggctgccgcttctccgcggccctgaccggcgactgcatg
ggagtcggtgtccgccgagcccgcgccaccgtccgccacggagcccaggtatttggagca
gcttctgggatgctttcagtgcatggcttccaacacaatcagcagcagcggaggaacctg
tccttacatgagtatctaagtatgggattactgaaagatgcaggcatctctgttcccaag
ggtcaagctgttcgtacacctgaagaagcatatgctgttgctaaagcatttggttcaaag
gatcttgttgtcaaagcacaagtattagctggtggtagaggaaaaggtgtatttgaaagt
ggtttaaaaggaggagtgaaaattgtttattctcccgaggaagccagggacacatcttca
aaaatgattggaaagaagttgtataccaagcagactggagagaaaggaaggatatgcaac
caggtttttgtctgtgagcgaagatatcccaggagagaatattacttcgcaataacattg
gaacgatcctttcagggaccagtattaataggtagctcacaaggaggagtcaatatagaa
gacgtagcagctgagaaccctgaagcaattgtcaaagaacctattgatattattgaaggc
attaagagagcgcaagctgtcaagattgcacagaaaatgggttttccagctaatgttata
gaagatgcagcagacaacatgatcaaattgtatgaggtttttatcaaatacgatgccagt
atgattgagataaaccctatggtggaggatgcaaatggaaatgtgatgtgcatagatgcg
aagataaactttgattctaatgctgcttttcggcaaaaggaaatatttgcccttcaggac
tggagtcaagaggatgaacgagaaaggacagcagctcaagcaaatctcaattacattgga
ctagatggaaccatcggttgcttggtaaatggtgctggtctggccatggccactatggat
ataataaaacttcatggaggaacacctgccaattttcttgatgtaggtggtggggcaaca
gctcagcaagtgaaagaagcatttaagcttattacttcaaacaaaaaggtactcgctatt
ctggtaaatatatttggtgggatcatgcgctgtgatattattgctcaaggtatcattatg
gctgtaaaagacttagaattgaagattcctattgttgttagattgcaaggttctaaggtt
gatgatgctaaagcactgattgcttccagcaccctcaagattttaggatgtgatgacttg
gatgaagctgctaaaatggttgtaaagctttcagaaatagtatctttggcaatggaggct
caggtggatgtcaagtttgagctgccaatttaa

DBGET integrated database retrieval system