KEGG   Callorhinchus milii (elephant shark): 103179208Help
Entry
103179208         CDS       T03088                                 

Gene name
abhd12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmk01002]
    103179208 (abhd12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103179208 (abhd12)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103179208 (abhd12)
Peptidases [BR:cmk01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   103179208 (abhd12)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   103179208 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Peptidase_S15 Abhydrolase_2 Acyl_transf_2
Motif
Other DBs
NCBI-GeneID: 103179208
NCBI-ProteinID: XP_007892546
Position
Un
AA seq 396 aa AA seqDB search
MRRRNNSQTVEHDSTITGSEKDSAQFESQVRHNHKPSAAAERGREEESGANAPSLSDSGM
KTGCRRRYRLLDRVKKVALWLLTVYICIPFLVKLCPAIQAKLVFLNFVRVPYFIDLKRPQ
DQGLNHTCNLYLHPEEAISIGVWHTVPASLWKEAQGKDETWYTGSLKSGHSIMLYFHGNA
GTRGGDHRVQLYKVLSEQGFHVIALDYRGWGDSKGTPSESGMSTDAIYTYNWLKARSGKS
SIYIWGHSLGTGVGTNVVRHLCEKETPPGALILESPFTNIREEAKSHPFSLIYRYFPGFD
WFFLDSIAENNIIFPSDDNVKHITCPLLILHAEDDGVIPFHLGRKLYNIAAASQKSPKIR
FIPFHKDLGYRHKYIYKSPELPQILREFLKDSTSPQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggaggaataattcccagacggtagaacatgacagcaccatcaccggctcggaa
aaggactctgcacagtttgaatcgcaagtgagacataatcacaagccatcggcagcagca
gagagaggcagagaggaggaatctggagcaaatgccccatctctttcggattcaggaatg
aaaacaggctgcagaaggcgatatagactgttggacagagtcaagaaggtagcgttatgg
ctgttaacagtgtacatatgcattccattccttgtgaagctatgtccagccatccaagcc
aaactggtcttcttaaattttgtgcgagtgccatatttcattgatctaaagaggccacag
gaccaagggctgaatcacacatgcaatttataccttcatcctgaagaagcaattagcatt
ggtgtctggcacacagtaccagcgagtctgtggaaagaagctcagggaaaggatgagacg
tggtatacaggaagcttgaaatcaggccattccattatgctttacttccatggcaatgca
ggcaccagaggtggagaccacagggtacaactatataaggtgctcagtgaacaaggcttt
catgtcattgcgctcgattacaggggatggggggattcaaaagggaccccttcagaaagt
ggcatgagcactgacgctatctacacttacaactggttgaaagcaaggagtggtaagagt
tcaatctacatctggggccactcattaggcacaggagttggtacaaatgtcgtaaggcat
ctatgtgaaaaagagacccctcctggtgccttaatactggagtctcccttcaccaatatt
cgagaagaagccaaaagtcatccattttcactgatctacaggtactttcctggctttgac
tggttcttcctggattccatcgcggagaacaatattatattccctagtgatgacaatgtg
aaacacatcacatgtccattacttattcttcatgcagaggatgatggtgtcattccgttt
catctgggaagaaagctttataacattgctgcagcttcacaaaagagtccgaagatacgg
ttcattcctttccataaagaccttggctacagacacaaatacatatataagagcccagaa
cttcctcaaatattaagggaattcttgaaggactcaacttctcctcaataa

DBGET integrated database retrieval system