KEGG   Callorhinchus milii (elephant shark): 103180014Help
Entry
103180014         CDS       T03088                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
cmk04060  Cytokine-cytokine receptor interaction
cmk04068  FoxO signaling pathway
cmk04210  Apoptosis
cmk04217  Necroptosis
cmk05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103180014
   04068 FoxO signaling pathway
    103180014
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103180014
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103180014
   04217 Necroptosis
    103180014
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103180014
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103180014
   04052 Cytokines and growth factors [BR:cmk04052]
    103180014
   04090 CD molecules [BR:cmk04090]
    103180014
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103180014
Cytokines and growth factors [BR:cmk04052]
 Cytokines
  Tumor necrosis fators
   103180014
CD molecules [BR:cmk04090]
 Proteins
  103180014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF LapA_dom Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 103180014
NCBI-ProteinID: XP_007893802
UniProt: A0A4W3K0U9
Position
Un
AA seq 245 aa AA seqDB search
MQQNYLYPQIYMVDGNPNINPCVTAPAWSLQPLKKKRKLDWRNIGTILILFLVLLALAGV
ALGTMHIMQLQKELNELKQVNTAREPRTEKQIGFRNLTVPVKQKEKAAHLTGKSFTGDSK
TIMWEDSLGHAFTRGIQYKDRGLLINETGLFFIYSKVYFRGQICQKNMYLEHNVFKRTER
YPKDIILMEMKTLNPCTGNGARWIKNSYEAGIFQLSKGESVYVNVSRPELVSFDESKTFF
GLYKL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagaattatttatatccacaaatctacatggtggatgggaatccgaatatcaac
ccttgtgtgacagcacctgcctggtcattacaaccattgaagaagaaaaggaaattagac
tggaggaatataggcactatcctgattctgttcttggtcctcctagcattagcaggggtg
gcattgggcacaatgcacataatgcaactccaaaaggaactgaatgaattgaaacaggtc
aatactgccagagaaccacggacggagaagcaaattggatttcgaaaccttacagtccct
gtcaaacagaaagaaaaagctgcacatctcacgggaaagagctttactggggattccaag
acaattatgtgggaagacagtttgggccatgccttcaccagaggcatacaatacaaagac
agagggttacttatcaacgaaacagggcttttcttcatttactccaaggtctatttccga
gggcagatctgccagaagaatatgtacttagaacacaacgtgttcaaacgaactgaacgc
tatcccaaagacataatcttaatggaaatgaagacgctcaacccgtgcactgggaatgga
gcacgatggatcaagaatagctatgaagcaggaatatttcagttatccaaaggagaaagt
gtttatgtcaatgtgtctcgaccagaattagttagttttgatgaatctaaaactttcttt
ggtttgtataaactgtaa

DBGET integrated database retrieval system