KEGG   Callorhinchus milii (elephant shark): 103180707
Entry
103180707         CDS       T03088                                 

Gene name
rdh5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103180707 (rdh5)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     103180707 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 103180707
NCBI-ProteinID: XP_007894885
UniProt: A0A4W3KDE7
Position
Un
AA seq 318 aa
MWLCLVCGVILLALGWVVRDRQKISSVKDKYVLITGCDTGFGNLLAKTLDKRGFRVLAGC
LTQRGADDLQRSCSSRLQTTLLDVTDNGSIQKAMEWAKAEVGEKGLWGLVNNAGRSTPIG
PTEWLRMEDYHKVLSVNLTGLIEVTLSFIPLVKRAKGRIVNTASVMGRISFAGGGYCLSK
CGVESFSDSLRRDMQYSGVRVSIIEPGFFKTAMTNLEGIEKDLDRLWGRLAPDVRESYGQ
QYFDKYVNIQKLSMNILCDTDLTKVTWCMEHALVAKYPRTRYAAGWDAKFFWVPISYAPT
LICDFMLALLLPKPAHSV
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggttgtgtctggtctgcggtgtgatcttgttggccctcggttgggttgtgagagac
cgtcagaagatcagcagcgtcaaggacaagtatgtcctcatcactggctgcgataccggc
ttcgggaacctactggcaaagaccctggacaagagaggcttccgtgtcctggccggctgc
ttgacccaacgaggtgccgatgatcttcaaaggagctgctcgtccaggctccaaaccact
ttgttagacgtgacagataacggcagcatccagaaggccatggaatgggccaaggccgag
gtgggggagaaagggctgtggggattggtgaacaacgctggaaggtccacccccatcggc
ccgacagagtggctgaggatggaagattaccacaaggttctgagcgtgaacctgacgggg
ctgattgaggtgaccctgagcttcatccccctggtgaaaagggccaaggggcgcattgtc
aacacggccagcgtgatgggccgcatctccttcgccggcggaggttactgcctctcaaag
tgcggagtggaatcattctccgatagcctgaggagggacatgcaatattctggggtgaga
gttagcatcatcgagcctggcttcttcaagacagcgatgaccaacttggaagggatcgag
aaagaccttgatcgcctgtggggcagactggctccagacgtacgtgagagttacggacaa
caatattttgacaaatacgtgaacatccagaagttgtcgatgaacatcttgtgcgacacg
gacctcacgaaggtcacgtggtgcatggagcacgccctggtggccaagtaccctcgcaca
cgctacgctgcaggctgggatgccaagttcttctgggtccccatctcctacgcccccacc
ctgatctgtgacttcatgctggcccttctgctccccaaacctgcccacagcgtctga

DBGET integrated database retrieval system