KEGG   Callorhinchus milii (elephant shark): 103180852
Entry
103180852         CDS       T03088                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103180852 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cmk03000]
    103180852 (mecom)
Transcription factors [BR:cmk03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    103180852 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_11 zf-BED zf-met SET zinc_ribbon_15 PyrI_C
Other DBs
NCBI-GeneID: 103180852
NCBI-ProteinID: XP_007895112
Position
Un
AA seq 1236 aa
MGGSYGEDSLYDGYSAIVPEEEPQADAEMGSLSLSAQDLSSPATSIEDFTPKEGSPYKAP
IYFPDDIPIPEEFELRESNIPGTGLGIWTKRKIEVGEKFGPYVGEELSSLKDPFHGWEVL
DELGNVKFCIDASQPDIGSWLKYIRYGRSYDQHNLVASQINDQIFYKAICNIDPGEELLV
LMKSGECSQEGMAPEIHEDSQYRCDDCNKIFESKAQLLDHQKFTCSNSHSAFSLVDESFK
QKLSGSDDELHECKECNGVYSDTQSLNRHMLTHTEEREYKCDQCPKAFNWKSNLIRHQMS
HDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHS
SVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKN
HFATGGLFGQGITLANAPVLDKSNVVNMNHSNSGLADYFGTNRHPAGLTFPAAPGFPFSF
PGLFPSGLYHRPPLMPASSPLKGLLSTELATKHHSHLLAASQLLPGTPDVLKALNRQSSS
DEVRPLEIPTEKMPEEKPRGKGSDQSESSDLDDVSTPSGSDLETTSGSDLESDVESDKEK
NKENGKSAEDVLVSPQKISSLNNSKKEFSNHSLFSPPLDEQIAVTGAVNDSIKAIASIAE
KYFGSTGLVGMQDKKVGPLPYPSMFPFQFFPAFSQPIYPFPDRDMSVTPLKIEPPSPSEL
KKLRSVNAESPYDLTTKRKEEKAMVPVASKPPAPHFPGEEQPLDLSMSSRSRASVSTQVE
PRKNHIFGERRGPNIEQPKSSEHSLQHAKPTPFFMDPIYRVEKRKLSDPVEALKQKYMKP
APGFLFHPQFHLPDQRIWMSAIENMAEKLEGFSSLKPEANDLLQSVPSMFDFRAPPSVIP
DNLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRN
IHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSSTANSSPHSEIDGSGAILDDKEDS
YFTEIRNFIGNSNRADCSPGHLEERINGGHCQEEKVPVTSQKTDELEDEEVVEDVEEEDE
EEVGSSLAGKPLNEPIVCKLDTDDQDRIQYDELREMEGNGKESPSSYKEDDDMRLEAKGG
LSALEHIRHFTDSLSARQPEASQFSEANLTTYSTTHLPEDLKQPLYRKSKSQAYAMMLSL
SDKEPIHSASSEGSNVWHSMARAGAEPSTIQSISHV
NT seq 3711 nt   +upstreamnt  +downstreamnt
atgggaggaagttatggcgaggacagtctttatgatgggtattctgcaattgtaccagaa
gaggagccacaggctgatgctgagatgggatcattgtctctcagtgcacaggatctttct
tcacctgccacatccattgaagacttcactccaaaagagggctccccatacaaagctccc
atatacttccctgatgacattcccattccagaagaatttgaactgcgcgagtcaaatatt
cctggtaccggattaggaatatggactaaaagaaagattgaagtgggtgaaaaatttgga
ccctatgttggagaagagctatcaagcctgaaggacccttttcacggctgggaagtcttg
gacgagttaggcaatgtgaagttctgcatcgatgccagtcagcctgatatagggagttgg
ctcaaatacatcaggtacggacggagctatgatcagcacaacctcgttgcatcccagata
aatgatcagattttctacaaagctatctgcaacattgacccaggggaggagctcttagtg
ttgatgaaaagcggcgagtgctcacaggagggaatggctccagagatacatgaggacagt
cagtatcgctgtgatgattgcaataaaatcttcgaatccaaggctcagctgctggaccat
cagaaatttacctgcagcaattcacactccgccttctctttggtggacgagagcttcaaa
cagaagctgagcggcagcgacgatgaacttcacgagtgtaaggagtgtaatggagtgtac
tcagatactcaaagtttgaataggcacatgctgacacacactgaggagcgagagtacaag
tgcgaccagtgccccaaagctttcaactggaagtccaacctcatccgccatcagatgtca
cacgacagtggcaagcattacgaatgtgaaaactgtgccaagcaggtttttacggacccc
agcaatctacagagacacattcgctcacagcacgtgggggcccgtgcacacgcctgccct
gagtgcgggaagaccttcgccacctcctcgggcctcaaacaacacaagcacatccacagc
agtgtcaagcccttcatatgtgaggtttgccacaaatcctacacgcagttctccaacctc
tgccgccacaaacggatgcacgccgactgcaggacacagatcaaatgcaaggactgcggc
caaatgttcagcaccacctcatcgctgaacaaacacaggaggttctgtgagggcaagaac
catttcgccacggggggactctttggtcaaggcattacacttgctaatgctccggttctg
gacaagtccaatgtggttaacatgaaccacagcaattccggtcttgctgactattttggc
accaataggcacccagctggacttacattccctgcagcccctgggttcccatttagcttt
cctggcctcttcccttcagggctgtaccaccggccgccattgatgcctgccagttcacca
ttgaaaggactactgagcactgaactggccaccaagcaccatagtcacctcttggcagcc
tcccagctgctccctggcacaccagatgttttgaaagcactgaaccggcagtcgtcctcg
gatgaagtccggcccctggagattccgactgagaagatgcctgaggagaagccacgagga
aagggcagcgaccagtcggagagcagcgacttggatgatgtcagcacgcccagtggcagc
gacctcgagacaacctccggctccgacctggagagcgacgtggaaagtgacaaagagaaa
aacaaagaaaacggcaaaagtgcagaggatgtgctcgtcagccctcagaagatctcctct
ttgaacaatagcaagaaagagttctctaaccattccctcttctcaccgccgctggatgag
cagattgctgtcacaggagccgtcaacgattccattaaggccattgcgtctatcgctgaa
aagtactttggttctactggacttgttggcatgcaagacaaaaaagtaggaccgctgccc
tacccttctatgtttccctttcagttttttcctgccttttcccagccgatatatcccttc
cctgacagagacatgagtgtcacgcccttgaagatcgagccaccatcacccagtgaactg
aagaagctgcggagtgtaaatgccgagtcgccctacgacctcaccaccaaacgcaaggag
gagaaggccatggtacctgtggcctccaagccacccgctccccattttcccggtgaagag
cagccgctggatttgagcatgagcagcagaagccgagccagcgtcagcacccaggtggag
ccgcggaaaaaccatatcttcggggagagaaggggacccaacatcgagcagcccaagagc
tctgagcattctctccagcacgccaagccaaccccgttcttcatggatcccatatacaga
gtggagaagaggaagctgtccgatcccgtggaagcattaaaacagaagtatatgaaacct
gctccaggcttcctattccacccacagttccacttgcctgatcagagaatttggatgtca
gcaattgagaacatggcagaaaaactggaaggtttcagttcactgaagccagaagccaac
gatctcctccagtctgtcccctccatgtttgactttagagctcccccgtccgtcattcct
gacaatctgctgaggaaaggcaaggagcggtacacctgcagatactgtggtaagattttt
ccaagatcagcaaacctgacgcggcaccttcggacccacactggagaacagccatacagg
tgcaagtactgcgaccgctcgttcagcatctcctccaacctccagcggcacgtccgaaac
attcacaacaaggagaagccttttaagtgtcacctgtgtgacaggtgcttcgggcagcag
accaacctggacaggcatctgaaaaagcacgagaacggaaacatgtccagtactgcaaac
tcctcccctcattccgaaatcgatggaagcggtgccatcctggacgacaaggaagattcc
tactttacagaaatccggaatttcattggaaacagtaatcgcgctgattgttccccagga
cacttagaggaaaggatcaatggaggtcattgccaggaggagaaagtccctgtgaccagc
cagaagactgacgagcttgaggatgaggaggtagtggaagatgtggaggaagaggatgaa
gaggaagttggatctagcctggcaggaaaacccctgaatgaaccgattgtatgtaaactg
gacacagatgaccaagacagaattcaatatgatgagctgagggaaatggagggaaatgga
aaggaatcccccagcagttacaaagaagatgatgacatgagacttgaagcaaagggtggc
ctttccgccctggaacacatcaggcacttcacggacagcctcagcgcgaggcagccggag
gcaagtcaattcagcgaggccaatctgaccacatacagcactacacacctgccggaagac
ctaaagcagcctttatataggaaatccaagtcacaggcatatgccatgatgctatctctg
tctgataaggagccaatccactctgcatccagcgagggatcaaatgtgtggcacagcatg
gccagagctggggcagagcccagcaccatccagtccatcagccatgtatga

DBGET integrated database retrieval system