KEGG   Callorhinchus milii (elephant shark): 103180855Help
Entry
103180855         CDS       T03088                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00010  Glycolysis / Gluconeogenesis
cmk00562  Inositol phosphate metabolism
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103180855 (minpp1)
   00562 Inositol phosphate metabolism
    103180855 (minpp1)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103180855 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103180855 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 RE_AspBHI_N
Motif
Other DBs
NCBI-GeneID: 103180855
NCBI-ProteinID: XP_007895110
Position
Un
AA seq 508 aa AA seqDB search
MIMAVRMRMSGGGRSRGTAVLLLWVFLRCCSGSSSGQWREASPPWAQYYGTKMRYEDVAG
SGPGSSRALGGCQALQLNALIRHGTRYPTRKNVPAMKRVHRLIRERADRGLGLVRALADW
HMWYDERMDGHLHPLGVTDMSGLAERLSRCFPEIFSPRRDWNRRLKFVSSSKHRCVNSTR
AFIQALERLLEPGGRAQPGGRWEVDDTLLRFFDHCHRYIQSVDRNQTAMRQVQRFLQGPE
MGAVIANMARKLGIGPENITTDMVQATFYLCTFEYVLKDVVSPWCDVFDKEDVEKLEYWG
DLKHYWKRSYGHKINGLSSYNLFQDIFQHLDQAVEESERLSVPVRNSVLRWFTPSTGLSL
NASFVRDAPEKTRGEYISHTAVLRFGHAETLLPILTLMGYFKDKNPLLADNFAEQKNRKF
RSGRISPFAANLIFVLYRCEKAQDLAEKYKLQLLLNEKPLPFLHNGDSVAGYGEVKSHYE
HALEVRSFDNVCEVAAQEALNVTHCGEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgataatggcggtgaggatgaggatgagcggaggcggccggagccgggggacggcggtg
ctgctgctgtgggttttcctgcgctgttgctcggggtccagcagcggccagtggcgggag
gcctcgccgccctgggcccagtactacggcaccaagatgcggtacgaggacgtggcggga
agcgggcccggctcaagccgggctctcggcggctgtcaggcgctgcagctgaacgcgctg
atccgacacggcacccgctacccgactcgcaagaacgtgccggcgatgaagagggtgcac
cggctgatcagggagcgggcagaccgaggcctgggcctagtccgggccctcgccgactgg
cacatgtggtacgacgagcggatggacggtcacctgcacccgctgggggtcaccgacatg
agcggcctggccgagcgcctgagccgctgcttccccgagatcttcagcccgcgccgcgac
tggaaccggcgcctcaagttcgtcagcagctccaaacaccggtgcgtgaacagcacccgc
gccttcatccaggccctggagcggctcctcgagcccggcggccgggctcagccgggcggc
cgctgggaggtggacgacacgctccttcgcttcttcgaccactgccaccggtacatccag
tcggtggatcgaaaccagacggccatgcggcaggtgcagcgcttcctgcagggcccagag
atgggggcggtgatcgccaacatggcgaggaagctgggcatcgggccggagaatataacc
actgatatggttcaagccacattttacctttgtacattcgagtacgttcttaaagatgta
gtttcaccctggtgtgacgtctttgataaagaagatgttgagaagttggaatattggggt
gatctgaaacattactggaagagaagttatggccataaaattaatgggctttccagctac
aatctgtttcaagacatattccagcatttggatcaagcagtagaagagagtgagaggtta
tctgttccagtaagaaactcggtcttgaggtggtttacccccagtacagggttgtccctt
aatgcaagttttgtccgggatgcacctgaaaaaacaaggggcgaatacatatctcatact
gctgttctgcgttttggacacgcagagactcttctaccaatccttactcttatgggctat
tttaaggacaagaacccattgttagcagataattttgctgaacaaaagaatagaaaattc
agaagtggtcggatttcaccctttgctgcaaatctcatttttgtgctataccggtgtgaa
aaagcacaagatctagcagaaaagtacaaactacagctgttgctgaatgagaagcctctg
ccatttcttcacaatggagattctgttgctggctatggagaagtgaagtcccactatgaa
catgccctagaagtgcgcagttttgacaatgtatgtgaggttgctgctcaagaagcctta
aatgttacacattgtggtgaattgtaa

DBGET integrated database retrieval system