KEGG   Callorhinchus milii (elephant shark): 103181168Help
Entry
103181168         CDS       T03088                                 

Gene name
erp44
Definition
(RefSeq) endoplasmic reticulum protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmk04131]
    103181168 (erp44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103181168 (erp44)
Membrane trafficking [BR:cmk04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    103181168 (erp44)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103181168 (erp44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6 Thioredoxin_2 HyaE
Motif
Other DBs
NCBI-GeneID: 103181168
NCBI-ProteinID: NP_001279431
UniProt: K4GFA1
Position
Un
AA seq 409 aa AA seqDB search
MTVTARLLRSGFIRYLLVLVAMWFSTPAHSEILNLDSGNIDDILGNADVALVNFYADWCR
FSQMLHPIFEEASTIVKDEYPDAKQVVFARVDCDQHADIAQRYRISKYPTLKLFRNGMMM
KREYRGQRSVTALADFIKQQRNDPIHEIQSLDELQTIDRSKRNIIGFFEQRESDNYRTFE
KVANILRDDCVIQAAFGSVAKPERFSGDNVIYKPIGENSPDMVYLGSLNNFDLSFAWTQD
KCVPLVREITFENGEELTEEGLPFLILFHLKEDTESLDKFQHEVARQLISEKGTINFLHA
DCDKFRHPLLHIQKAPADCPVIAIDSFRHMYVFADFKDLAIPGKLKQFILDLHSGKLHRE
FHHGPDPTDTAPGQQQSEEVQSSPPESSFQKLAPSEHRYTILKRSRDEL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacagttacagcgcggcttcttcgctctggctttatacgttacctcctcgtcctggtg
gccatgtggtttagtactccagctcatagtgaaatattaaatcttgatagtggaaatatt
gatgacatcttaggcaatgcagatgttgcactagtcaatttctacgctgactggtgcaga
ttcagtcaaatgttgcatcccatctttgaagaggcttccacaattgtgaaagatgaatat
ccagatgcaaagcaagtggtttttgcaagggttgattgtgaccagcatgcggatatagca
caaaggtaccggataagtaagtatccaacgctgaaactgttcaggaatgggatgatgatg
aagcgagagtacagaggtcagagatcagtgacggcacttgcagacttcatcaaacaacag
agaaatgatcctattcacgaaatccaaagtctcgatgaattgcaaacaattgatcgcagc
aaacgtaacatcattggattttttgaacaaagagagtcagacaactacagaacctttgaa
aaagtggccaatatattgcgggatgattgtgtcattcaggccgcttttggaagtgttgca
aaacctgagaggttcagtggtgataacgtaatatacaaaccaattggggagaacagtcct
gacatggtgtatttgggttcgctgaataattttgatctgtcgtttgcctggactcaggat
aagtgtgtgccattggtgagagaaatcacttttgaaaatggtgaggagttgactgaagaa
ggccttccattccttatactgtttcatttgaaagaagacactgaaagcttagataaattt
cagcatgaagttgcaagacagttgatcagcgagaaaggtacaataaacttcctacatgct
gactgtgacaagttccgtcatcctctcctccacatacagaaggctccagcagactgtcct
gttattgctattgacagttttaggcatatgtatgtttttgcagactttaaagacttagca
attccaggtaaactgaagcagtttatattggacctacactctggtaaattacacagggaa
tttcaccacggcccagatcccactgatacagctcctggacagcagcaaagtgaagaagtc
caaagtagtcccccagaaagttcattccagaaactggctcccagtgaacacaggtatacc
atcctcaagagaagccgagatgaattatag

DBGET integrated database retrieval system