KEGG   Callorhinchus milii (elephant shark): 103181195Help
Entry
103181195         CDS       T03088                                 

Gene name
ddc
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00350  Tyrosine metabolism
cmk00360  Phenylalanine metabolism
cmk00380  Tryptophan metabolism
cmk01100  Metabolic pathways
Module
cmk_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
cmk_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103181195 (ddc)
   00360 Phenylalanine metabolism
    103181195 (ddc)
   00380 Tryptophan metabolism
    103181195 (ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103181195 (ddc)
Enzymes [BR:cmk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103181195 (ddc)
    4.1.1.105  L-tryptophan decarboxylase
     103181195 (ddc)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103181195 (ddc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 103181195
NCBI-ProteinID: XP_007895676
UniProt: V9KQR9
Position
Un
AA seq 480 aa AA seqDB search
MDYEEFRTRGKEMVDYVVDYLQSIEERPVYPSVEPGYLRHLIPESAPEQPHSFEEVMKDV
ERVVMPGITHWHSPHFHAYFPTGNSVPGMLGDMLSNAISCIGFSWAASPACTELETVMLD
WLGKMLNLPHQFLAGTNGEGGGVLQSTASEATLVGLLAARRKKVLHIQADTPDLEERMIM
TKLVAYMSDQSHSSVERAGLIGGITMRKLPSDSQLSLRGETLKQAIEEDKAAGLIPFFLC
ATLGTTASCAFDSILELGPICNSEKVWMHIDAAYAGSAFICPEFRPLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRSDLIGAFKVDPLYLKHEHQDSGLITDYRHWGIPLGRRFRSL
KMWFVFRMFGIKGLQEHIRKQVNLAHEFEGLLLQDKRFEIASDVVLGLVCFRLKGSNDLN
EMLIKRINAGRKIHMVPCNLQDKFVLRFAVCAATTESKHIHYAWQIIKELATELLDEGYQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggactacgaggaattccgcaccagagggaaggagatggtggattatgtggtcgattac
ctgcagtccattgaggagcgtcccgtttacccgtctgtggagcccggctacctgcgccat
ctcatcccagagagcgcccccgagcagccccactccttcgaggaggtgatgaaggatgtg
gagagggtggtcatgccagggataactcactggcacagtccacatttccatgcctatttc
cccacgggaaactccgtgccgggtatgctgggtgacatgctctccaatgctatcagctgt
attggcttttcctgggctgcaagtcccgcatgtacagagctggagactgtgatgcttgat
tggctggggaagatgctgaacctgccccatcagttcctagctgggaccaatggagaaggc
ggtggagtgttacagtccacagccagtgaggcgaccctggtgggactccttgctgcaaga
agaaagaaggttttacacatccaggcagatacgcctgatcttgaagagaggatgatcatg
acaaaactggttgcctacatgtcagatcagtctcacagctctgttgaacgagcaggattg
attggaggaataacaatgagaaagttgccctctgacagccagctcagcctgcggggagag
accctgaaacaagcaatagaagaagataaagctgctggtctgattcctttcttcttgtgt
gcgacactgggcaccaccgcttcctgtgcatttgattcgattttggagctaggaccgatc
tgtaattctgaaaaagtctggatgcacattgatgctgcttatgcaggaagtgcttttatt
tgcccagaattcagacctttattaaacggtgtcgagtttgcagattctttcaactttaac
cctcataaatggctccttgtgaactttgattgctcagcgatgtgggtgaagaaaagatca
gaccttatcggtgcttttaaagtggatcctctttaccttaaacatgagcatcaggactct
ggacttatcactgattacaggcattgggggattccactcggacgcagattccgctctctg
aaaatgtggtttgtgttccgaatgtttggaataaaaggtcttcaagaacatattcgcaag
caagtgaatcttgcgcatgagttcgaaggcttactacttcaagataaaaggtttgagatt
gcgtctgatgtcgtgttgggactagtgtgcttcagactcaaggggtcaaatgatctcaac
gaaatgctcattaaaagaatcaacgcagggagaaagatccacatggtgccatgcaatctt
caagacaagtttgtgcttcgttttgccgtatgtgcagctacaactgaaagtaaacatatt
cattatgcttggcagatcataaaggagcttgctacggagctgcttgatgaaggctatcag
tag

DBGET integrated database retrieval system