KEGG   Callorhinchus milii (elephant shark): 103181422Help
Entry
103181422         CDS       T03088                                 

Gene name
pcbd1
Definition
(RefSeq) pterin-4 alpha-carbinolamine dehydratase 1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00790  Folate biosynthesis
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103181422 (pcbd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103181422 (pcbd1)
Enzymes [BR:cmk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     103181422 (pcbd1)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103181422 (pcbd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 103181422
NCBI-ProteinID: XP_007896082
UniProt: A0A4W3GU35
Position
Un
AA seq 109 aa AA seqDB search
MTSPGFKAGKAHRLNPEEREQFLPNLRAVGWVEVDGRDAIYKEFIFKNFNQAFGFMTRVA
LQAEKMDHHPEWFNVYSKVHITLSTHDCGGLSERDINLATFIEEATVSQ
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgacatctccaggtttcaaggcaggaaaggcgcacaggctgaaccccgaggaaagagag
cagttccttcccaacctccgagctgttggttgggttgaagtggacgggcgtgatgcaatt
tataaagaattcatctttaaaaactttaatcaggcttttggtttcatgacaagagtcgct
ttacaggccgaaaaaatggaccatcacccagaatggttcaatgtttattctaaggtccat
ataacactaagtacacatgactgtggagggttgtcagagcgagatattaacctggctacc
ttcattgaagaagctacagtttctcaataa

DBGET integrated database retrieval system