KEGG   Callorhinchus milii (elephant shark): 103182495Help
Entry
103182495         CDS       T03088                                 

Gene name
mapkapk2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
cmk04218  Cellular senescence
cmk04370  VEGF signaling pathway
cmk04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103182495 (mapkapk2)
   04370 VEGF signaling pathway
    103182495 (mapkapk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103182495 (mapkapk2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103182495 (mapkapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmk01001]
    103182495 (mapkapk2)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103182495 (mapkapk2)
Protein kinases [BR:cmk01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   103182495 (mapkapk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Choline_kinase
Motif
Other DBs
NCBI-GeneID: 103182495
NCBI-ProteinID: XP_007897739
Position
Un
AA seq 316 aa AA seqDB search
MLAGILGRGKQMLQDCPKARREVDLHWRASGCTHIVRIIDVYENLYQSKKCLLIVMECME
GGELFSRIQDRGDQAFTEREASEIMKNIGEAVQHLHSVNIAHRDVKPENLLYTTKRPNAI
LKLTDFGFAKETTSYNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPP
FYSNHGLAISPGMKKRIRMGQYEFPNPEWVEVSEEAKDLIRHLLKTEPTQRMTINEFMNQ
PWIIQSTQVPQTPLHTSRVLKEEKDLWEDVKEEMTSALATMRVDYEQIKIKKIEESCNPL
LMKRRKKATTSNAPSH
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgggattctgggaagaggaaagcagatgcttcaggattgcccgaaagcccgg
cgagaggtagatctgcactggagagcatctggctgcacacacattgtacgaattatagac
gtctacgaaaatctctaccagagtaaaaagtgtctacttattgtaatggaatgtatggaa
ggaggtgaactgtttagcagaatccaggaccgaggggatcaagcattcacagaaagagag
gcttctgaaatcatgaagaacattggagaggccgtacagcacctccactcggtgaacatt
gcccatcgagatgtcaagcccgaaaatttgttgtacacgacgaaaaggccaaacgctatt
ttgaaactaaccgacttcggatttgccaaagaaaccaccagctacaactcgttagcaacc
ccttgttacacaccgtattacgtggctcccgaagtgcttgggcctgagaagtacgacaag
tcatgtgacatgtggtccttgggcgtaataatgtacattctactgtgtgggtatcccccg
ttttattcgaaccacggtctggccatctcacctggaatgaagaaacggatccgaatggga
cagtatgagttccccaacccggagtgggtggaagtatccgaggaagccaaagatctgatc
cgacatctcctaaaaactgagcctacgcaacgcatgaccatcaacgagttcatgaaccaa
ccgtggatcattcaatcaacgcaggtcccacagacaccccttcataccagcagagtgctg
aaagaagaaaaagatctgtgggaggatgtaaaggaggaaatgaccagtgccttggcaacc
atgagggtggactacgaacaaatcaaaatcaaaaagatcgaggagtcttgcaaccctctg
cttatgaagaggagaaaaaaggcaacaacctcgaatgcacccagccactga

DBGET integrated database retrieval system