KEGG   Callorhinchus milii (elephant shark): 103183195Help
Entry
103183195         CDS       T03088                                 

Gene name
nsun2
Definition
(RefSeq) NOP2/Sun RNA methyltransferase family member 2
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmk03016]
    103183195 (nsun2)
Enzymes [BR:cmk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     103183195 (nsun2)
Transfer RNA biogenesis [BR:cmk03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    103183195 (nsun2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 103183195
NCBI-ProteinID: XP_007898726
UniProt: A0A4W3HHH3
Position
Un
AA seq 795 aa AA seqDB search
MGRRKNRPRNRDRNESTGAAAAGWGAGYQDIIKENELYEKYYKELKIVPVEEWDQFMASM
REPLPATIRITGYKSHAEEILQCLKTKYFKELQDLEVDGQQIEAPQPLKWYPGELAWHIN
ISRKMLRKSPVLEKFHQFLVSETESGNISRQEAVSMIPPLLMDIKPHHKILDMCAAPGSK
TAQLIEMLHSDMNIPFPEGFVIANDVDNKRCYLLVHQSKRLHSPCIMVINHDASNIPRLQ
MVEADGQRDILFYDRILCDVPCSGDATLRKNIDVWKKWTTSNSLQLHGLQQRIVIRGVEQ
LTVGGRMVYSTCSLNPIENEAVIATVLEKSEGTLELIDVSSELPGLKRMPGLTSWKVMTR
EGQWFADWSEVPENKQTQIRPTMFPTKDPEKLKAMNLERCIRVLPHHQNTGGFFVAVLQK
RATMPWNRREPKWRHKTAAVDGVLVAATEKGDTEIMDQTKEPEDSEESSAGKDRICCPPP
SKKMKLFGFKEDPFVFLNEDDPIFPPIETFYLLHSSFPKFNVLTRTHDGKKRHLYMVSKE
LRNVLLHNSERMKVINTGVKVLSRNNDGEQFGCAFRLAQEGIYTLNPYINGRIIKISIED
VMVLLTQENPFIGKLSSEAQKVAKKLVMGSIVLKYEPDPLNTEGPKCPIVLCGWRGKNSI
RAFVAKNERLHYLRMLGVEVFREKNKSEGLQNVTAGAEENEPTESKLKVVEEEEAAAVEK
VKEDLDRCEKSDETREATEKPGECLEDVKETKVEIETEGDVTKEIPDAINTCPNIEKSNS
AEETSSEADKLNVKP
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggggcgaaggaagaacagacccagaaatcgggacaggaacgagagcactggcgccgct
gccgctggttggggagctggctaccaagatattataaaagaaaatgagttgtatgagaaa
tattataaagaactaaagattgttcctgtggaggagtgggatcagtttatggcatccatg
agagagccactaccagccacgattagaataactggatataaaagccatgcagaggaaatt
ctgcagtgcctaaaaacaaaatatttcaaagagttacaagaccttgaagtggatggacaa
cagatagaggccccacagcccttgaagtggtatccaggtgaactggcttggcacataaac
atcagcagaaagatgctaagaaagtcacccgtcttggagaaattccaccagtttcttgtt
agtgaaactgaatctggaaatatcagtcgccaggaagctgtcagtatgattcctcctttg
ctgatggacattaaaccccatcacaagattcttgatatgtgtgcagcacctggatcaaaa
accgctcaactgattgagatgctacattccgacatgaatattccttttccagagggtttt
gtaattgcaaacgatgttgacaacaagcgatgttatctgttggttcatcagtcaaagcgc
ttgcacagtccgtgcatcatggtcataaatcacgatgcctccaacatacccagactacag
atggtggaggctgatggtcaaagggacattctcttctatgacaggattttgtgtgatgtt
ccttgcagtggtgatgccaccttaagaaagaacattgatgtgtggaaaaagtggacaacg
agcaacagcttacagttgcatggtttacagcagaggattgtaattcgtggtgtggaacag
ctgactgtaggtggcagaatggtctattctacctgctctctgaaccccattgagaatgaa
gctgtgatagcaactgttcttgagaagagtgaaggaacccttgagctaattgatgtttca
tctgagttgccggggttaaaaaggatgcctggattaacgtcatggaaggtaatgaccaga
gaaggccagtggtttgcggattggtcagaagtgccggagaacaaacaaacccagattcgc
ccaacaatgtttccaaccaaagacccagagaaactgaaagcaatgaacctagagagatgt
attagggtccttcctcatcatcagaacacaggaggattctttgtagctgttttacagaag
agagctacaatgccatggaacagacgggaaccaaagtggagacacaaaacagcagcagtt
gatggggtattggttgctgctactgaaaaaggagatactgaaataatggatcaaactaaa
gaacccgaggacagtgaggaatcatctgctggtaaagatagaatttgttgcccaccacca
tctaagaaaatgaaactatttggattcaaggaagatccctttgtgttcctcaacgaagat
gatccaatatttccaccaattgagacattttacctgctgcattcctcattcccaaaattc
aacgtcctcactaggactcatgatggaaagaaacgccacctctacatggtttcaaaggaa
ctaagaaatgtgcttctccacaatagtgaacgtatgaaggtaatcaacaccggagtcaaa
gttttaagtcgcaataatgatggggagcagtttggctgtgccttcagattagcgcaggag
gggatctatacattaaacccatacattaatggaagaatcataaagatttctattgaggat
gttatggttctattgacccaagagaatccattcatcggtaaactttcgagtgaagcccag
aaagtcgccaagaagctggttatggggagcattgtgctgaaatatgaaccggatccatta
aacactgaaggtccaaagtgccccatagttctgtgcggctggagggggaagaattcaatc
cgtgcctttgttgcaaagaatgagcgtttgcattacctgcgcatgttgggagtggaagtt
ttcagagagaagaataagagcgaggggttacaaaatgtgactgcaggcgctgaggaaaat
gaaccaacggagagcaaattgaaagtggtggaagaggaagaagctgcagctgtggagaag
gtgaaagaggatcttgacaggtgtgaaaaatctgatgagactcgagaagccacagaaaaa
cctggagaatgtctagaggatgtaaaggagactaaggtggaaattgagactgaaggtgat
gttacaaaggaaattccagatgctatcaatacttgcccaaacattgagaagtctaatagt
gctgaagagacatcttctgaggcagataaattgaatgttaaaccttaa

DBGET integrated database retrieval system