KEGG   Callorhinchus milii (elephant shark): 103184052Help
Entry
103184052         CDS       T03088                                 

Gene name
khk
Definition
(RefSeq) ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00051  Fructose and mannose metabolism
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103184052 (khk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmk04147]
    103184052 (khk)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     103184052 (khk)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103184052 (khk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Bro-N
Motif
Other DBs
NCBI-GeneID: 103184052
NCBI-ProteinID: NP_001279684
UniProt: K4G0L9
Position
Un
AA seq 254 aa AA seqDB search
MATQERKILCVGLVCLDIINVVDCFPVEDTDTRCLSQRWQRGGNASNSCTVLALLGTPCA
FMGSLAPGRVAENLPDVTIEDFKKVDLSQFKLIHWEGRNASEQIGMIQRVVQYNATVPAE
CRITISVEIEKPRQDLFSLFGHGDVVFVSKDVAGHLGYKSAPEAVKKLYSLVKPGAYLIC
AWAEKGADAWGPNGAVHSDAFPPENLVDTLGAGDTFNAAVLFSLSTGKCIQEALTFGCQI
AGKKCGILGYDGIV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaagagaggaagatcctctgtgttgggctggtctgtctggatattattaac
gtagttgattgctttccagttgaagacacagatacgagatgtttgtcccagaggtggcag
cgaggtggaaatgcctccaattcctgtacagtacttgcactgctcggcactccatgtgct
ttcatgggctcgctggcacctggacgagttgcagagaatctgcccgatgtaactatagag
gattttaagaaagttgatctctcgcaattcaagttgattcactgggagggcagaaatgca
tcggagcagattggtatgatacagcgggtggtgcagtataatgctactgtgccagcagag
tgccgaatcaccatctccgtggagattgagaaaccaaggcaagatctcttctcactcttt
ggacacggagatgtggtttttgtcagtaaagatgttgcaggacacttagggtacaaatca
gcacctgaagcagtgaaaaagctttacagccttgtgaagcctggtgcctacctgatctgt
gcatgggctgaaaaaggagctgatgcctggggccctaatggagctgttcattctgatgct
tttcctcctgaaaatcttgtggatactctgggagctggagataccttcaatgctgctgta
ttattttcactatccactggcaagtgcatacaggaggcactgacttttggctgtcaaatt
gctgggaaaaaatgtggcattctaggatatgatggaattgtctaa

DBGET integrated database retrieval system