KEGG   Callorhinchus milii (elephant shark): 103184489Help
Entry
103184489         CDS       T03088                                 

Gene name
hpgds
Definition
(RefSeq) hematopoietic prostaglandin D synthase
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00480  Glutathione metabolism
cmk00590  Arachidonic acid metabolism
cmk00980  Metabolism of xenobiotics by cytochrome P450
cmk00982  Drug metabolism - cytochrome P450
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103184489 (hpgds)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103184489 (hpgds)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103184489 (hpgds)
   00982 Drug metabolism - cytochrome P450
    103184489 (hpgds)
Enzymes [BR:cmk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103184489 (hpgds)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     103184489 (hpgds)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C GST_N_2 GST_C_2 GST_N_3 GST_C_6
Motif
Other DBs
NCBI-GeneID: 103184489
NCBI-ProteinID: XP_007900694
UniProt: A0A4W3I4C7
Position
Un
AA seq 237 aa AA seqDB search
MCPLFSNLKEILVLSHFEYTRFQRTYRIKLRENSKGSSMPHYRLTYFQLRGRAETARYIF
AYHGIKYEDNRIEWSDWPNIKPTLTFRQVPILEVDGVVINQSAAIARYLARETGLAGNTN
LEQAQVDAIADTINDFMNLFPWTEKDQTLKQKMIEDVFINNSNLYLDGIENLLGDKMWFV
GDSVTWADFHWAVCSITLTNLKADVLCSHPKLLSLKERVEELPSIAIWIKQRPNTVF
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcctttgttttccaatctcaaggaaattttggtgctttctcactttgaatacaca
cggtttcagagaacttacaggatcaagctccgagagaattcaaaaggttcaagtatgcca
cactacaggttaacctatttccagttgcgaggaagggccgaaaccgctcgctatattttt
gcttatcatgggataaagtatgaagacaataggatagaatggtcggattggcccaacata
aagccaactttgactttcaggcaagttccgatcctggaggtggatggagtagttatcaac
cagagcgcagctattgcgagatacctagcgagagaaacaggcttagcggggaataccaat
ttggagcaagctcaagtggatgccattgcggacacaattaatgatttcatgaatcttttc
ccctggacagagaaggaccaaactttgaaacaaaagatgatcgaagacgtcttcatcaac
aacagcaacttgtacctggatgggatagagaatttattgggagacaaaatgtggttcgtt
ggcgattcggttacctgggctgattttcactgggctgtgtgttccatcaccctcaccaat
ctgaaggccgacgtcctatgtagccatcccaaactgttatctctgaaagagagagtggag
gaacttccttcaatagccatttggataaaacaaagacccaacaccgtattctag

DBGET integrated database retrieval system