KEGG   Callorhinchus milii (elephant shark): 103184703
Entry
103184703         CDS       T03088                                 

Gene name
adamts13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cmk01002]
    103184703 (adamts13)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     103184703 (adamts13)
Peptidases and inhibitors [BR:cmk01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   103184703 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ADAM_spacer1 Reprolysin_5 Reprolysin_4 TSP1_spondin Reprolysin_3 TSP1_CCN Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 103184703
NCBI-ProteinID: XP_007901059
Position
Un
AA seq 1387 aa
MSLSFPITALLLLTQFTWVWTSLNQTVLWPRETDRSYFGTSSRNEAARASSSHVRARSIK
DTKHLELLVVVGHDVYQFHKQDTERYVLTNLNIAAELLRQPSIGAQLRVHLIKMLILTEP
EVPDLMQPEVTITTNLTSSLIGVCQWSRKINPEKDSEPLHADLVLFVTRFDLESDNGNQL
VRGVTQLGGLCSHTWSCVITEDTGFNLGITMAHEIGHSFGIRHDGEGNECTGNGHIMAAE
GGYNSVDLTWSECSRERFVTFLCTEQATCLRDLPATELYLSGRKPGLYYGADDQCKIAFG
DKASACTFNSQDIDMCKVLSCHTDPLDHSVCTRLFIPLLDGTECGPNKWCLKSSCTSLGD
LGPIGVVHGAWSRWSPQSDCSRTCGGGVTLRHRQCNNPRPAFGGRTCEGSQLHADMCNTE
PCWEMQLDFMSRQCSDTNSQPLYLTEKVPVYYKWLPALGYATGDALCKYMCRVEGKSFMV
SRGDFFVDGTRCELGSSDSATSHGVCVAGRCQVFGCDGRLESGMVLDVCGVCGGENSTCR
ELLGSYTAGAAREYVTFLTVPPGSTSVHVSNSKSVYSHLALKVKGQYLVAGKGKISLNVT
YPSRLEDNRMMYRLYLTRENFPHSEEIIIPGPTNETIEIQVYRKYRPEYGDIVNPNITFS
LYIPKNQSVYTWIPVTQPCSATCGTGVGRVQYICADGQTEEEVDTQHCSETLQPPARLEL
CSTTPCPPGWEVGPQGPCSVTCGGGWRERDMHCVRREGRKELRVADLECGSIPKPESVQK
CNTQGCPARWRVSAAGPCSASCGVGVAQQAATCVQIINGTDVEVNETWCGETERPTVLTQ
CIVSICLSELGTESWPGVSKKLGKEVETPGNGTSSPSVSVGSQTFLWVPRTGPCSASCGE
GVADLSYMCVDRETHEETQPEHCLQTFQAQVHQVHCTNQPCPPQWRYETDTCSVTCGGGV
RRRILYCARDVGLREELAPDGDCLHSPRPADHQPCSLHPCPARWRVSEPRRCSAVCGAGV
AERSVTCLQFQNGSDVEVNRALCGAETEPPAIVPCLVNICPFGLQASNWSECSHSCGIGI
RTRQELCLNLDSQQPVHRSFCDHLPTLLTTQSCDAGPCPTPGTSTPPTPTTSTTQALPAT
TQPPAAAPPPANGTQRLTQQGGTDTSVCGSLLLSESGILNLTGVQQRECWVSIGRPLGEV
VTVRILFSSFTCTARDFLTLMGRLLWWKTCSQLTGFTLTSITNTLTIRQRRANPGDGVVL
QYSSSLASRRYHRECDVQLYGPKGVIISPAHPYVKGKACRTFINVAPTSRIAIRVLYLRL
QVGINGTSSDYILIKDVGSQKYSAYRGNHIFLWQSMGSRAEIEFHGEFGFRALFWTVSPR
TPSRAAN
NT seq 4164 nt   +upstreamnt  +downstreamnt
atgagtctctcattccccatcacagctctgctacttttaactcaattcacatgggtgtgg
acatctctgaaccagactgtcctgtggccgagggaaacagatcgatcttattttggcact
agttcaaggaatgaagcagcccgagccagctcctctcatgtgagagcgagatccatcaag
gataccaagcacctggagctgcttgtggtggtgggacacgacgtttaccagtttcacaaa
caggacaccgagcgctacgtgctcaccaacctcaacatcgccgcagagctcctccggcag
ccgtctatcggtgctcaactccgagtccatctcatcaagatgctgatactgacagagcca
gaggtaccggatctgatgcagccagaagtcacaatcaccaccaacctcacctcgtcactg
attggtgtatgtcaatggagcagaaagattaaccccgagaaggactctgagcctctgcac
gctgatcttgtcctgtttgtcaccaggtttgacctggaatctgacaatggcaaccagctg
gttcggggggtgacacaactggggggcctgtgctcccacacctggagctgtgtcataact
gaggacactggcttcaacctcggcatcaccatggctcatgagatcggtcacagttttggc
attagacacgacggggagggcaacgaatgcacagggaacggccacatcatggcggcagag
ggcggctacaacagcgtggacctgacctggtccgagtgcagcagagagcgctttgtaacc
tttctctgcacagagcaagctacgtgcttgagggatctcccggccacagagttgtatctt
tctggccggaagccgggcttgtactacggagcggacgatcagtgcaagatcgcctttggg
gacaaggcttccgcctgcaccttcaacagccaggacatcgacatgtgtaaggttctgtct
tgccacaccgaccccctcgatcactcagtgtgtacccggctgtttattcctctgttggat
gggacagaatgcggcccgaacaagtggtgcttaaaaagcagctgcacctccctgggtgac
cttgggccgatcggagttgttcacggagcctggtccaggtggagcccacagagtgactgc
tcacgaacatgtgggggaggggtgactctcagacaccggcagtgtaacaacccaaggccg
gcatttggtgggcgcacctgcgagggatcacaactgcatgcagacatgtgcaacacagag
ccttgttgggagatgcagttggacttcatgtctcgccagtgctcagacactaattcacag
cctctttacctgaccgagaaggttcccgtttactataaatggctcccagcactcggctac
gccactggtgatgcactgtgtaagtacatgtgccgggtggaggggaagagcttcatggtg
agccggggagacttctttgtggacgggaccaggtgcgagctgggcagctccgactcagcc
acttcgcatggagtctgtgtcgcaggtcgctgccaggtgtttgggtgtgatggcaggctg
gagtctgggatggtgctggacgtgtgtggagtgtgtgggggtgaaaactccacctgcagg
gagctgttgggctcgtacacagcaggagctgcccgagagtatgtgaccttcctgactgtg
cccccgggttccactagtgtccatgtctccaacagcaagtccgtctattctcatctggcc
ctgaaggttaaaggtcagtatttggtagctggaaaaggcaaaatatcgttaaatgtcact
tacccatctcgtctggaggacaacaggatgatgtacagattgtacctgacccgggagaac
ttcccccattcggaagagatcattatcccgggccccacaaacgaaactattgaaatacag
gtgtatcggaagtacaggccggagtatggagatattgttaatcccaatatcactttcagt
ctctacattcccaagaaccagagtgtttacacctggattcctgtcactcaaccttgttca
gcaacttgtggtacaggtgttgggagggtacagtatatttgtgctgacggtcagacagag
gaagaagtggatacacagcactgctctgagacactgcagccccctgcacgcctggaactt
tgctccaccacaccctgccctccagggtgggaagtcgggccgcagggtccctgctcagtg
acgtgtggtggaggatggagggagcgggacatgcactgtgtgagaagggagggacgtaag
gagctcagagtcgctgatcttgagtgcggcagcattcctaaaccagagtctgtgcaaaag
tgtaacacccagggctgtcctgccaggtggagggtttcggctgcgggcccatgctctgct
tcctgtggggttggagttgcccagcaggctgccacctgtgtccagatcatcaatggaaca
gacgtggaggtcaacgagacatggtgcggagagacagagaggccgaccgtgctgacccag
tgtattgtcagcatctgtctctccgagctgggcacagagtcctggccaggggtctcgaaa
aagttggggaaggaagtggaaaccccggggaatgggacgagcagcccaagtgtcagtgtg
gggagccagaccttcctctgggtgccacgaacaggcccctgctccgcctcctgtggggaa
ggagtagcagatctcagctacatgtgcgtggatcgggaaacccacgaggagacacagccg
gaacactgtctgcaaaccttccaggcccaggtccatcaggtccactgcacaaaccaaccc
tgccctcctcagtggaggtacgagacagacacctgcagtgtaacctgcggagggggcgtg
aggcggagaatcctgtactgcgccagggacgtggggctgcgagaggagctggctcccgac
ggtgactgtctccattcccctcggcctgcagatcaccagccctgcagcctgcacccctgc
ccggccaggtggagggtgtcggagccgcggcgatgctctgccgtgtgcggggcgggggtc
gcggagaggagcgtgacctgcctccagtttcagaacggaagcgacgtggaggtgaacaga
gcgctgtgcggggctgagaccgagcctccggccatcgtaccctgtctggtcaacatctgc
ccctttggcttgcaagcatccaattggtctgagtgttcgcattcctgtggaatcgggatc
cgcacccggcaagagctgtgccttaacctggactcccagcagccggtgcaccgcagcttc
tgcgaccacctgcccaccttgctcaccacacagtcttgtgacgctggaccctgccccacg
ccaggcacctccacaccaccgactcccaccacctcgaccacccaggcactgcccgcaaca
acacagccccccgctgctgcaccaccaccagccaatggcacgcagcgtctcacgcaacag
ggtggcacagataccagtgtgtgtgggtcgctgcttctgagcgagtcggggattctgaac
ctgacgggtgtacagcagcgggaatgctgggtgtccatcggccggccacttggggaggtg
gtaaccgtgcggattctgttcagctcgttcacctgcactgcacgagatttcctgaccctg
atggggcgtttgctgtggtggaagacctgctcacaactgacgggcttcacgctcacgtcc
atcaccaacacgctcacaatcagacagcggagagcgaaccccggtgatggtgtggtactt
cagtactccagcagcttggcatcacgacgctaccacagagagtgcgatgtgcagctgtac
ggaccgaagggtgtgatcatcagccctgcccacccctacgtcaagggcaaagcctgccgc
accttcattaacgttgccccgaccagccgcatcgccatccgcgtgctgtacctcaggctg
caagtgggcatcaacggcacctcgtccgattacatcctgatcaaagacgtaggtagtcag
aaatactccgcctaccgggggaatcacatctttttgtggcagtccatgggcagccgagct
gaaattgaattccacggggagtttggcttccgagccctattttggactgtgagcccgaga
acccccagcagagcagccaactga

DBGET integrated database retrieval system