KEGG   Callorhinchus milii (elephant shark): 103185307Help
Entry
103185307         CDS       T03088                                 

Gene name
cpm
Definition
(RefSeq) carboxypeptidase M
  KO
K01296  carboxypeptidase M [EC:3.4.17.12]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cmk01002]
    103185307 (cpm)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cmk00537]
    103185307 (cpm)
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.12  carboxypeptidase M
     103185307 (cpm)
Peptidases [BR:cmk01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   103185307 (cpm)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cmk00537]
 Enzymes
  103185307 (cpm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 CarboxypepD_reg AstE_AspA GTP_cyclohydroI Dioxygenase_C
Motif
Other DBs
NCBI-GeneID: 103185307
NCBI-ProteinID: NP_001279591
UniProt: K4GD33
Position
Un
AA seq 417 aa AA seqDB search
MTFLWLWAIISSAVALNFTYHNGRQLETFLRAINQDYPSITHLYSIGKSVDGIDLWVLAI
GKYPTKHTVGIPDMKYVANIHGDEVVGREMLLHLIEHLVTMYGVNDNITALINSTRVHIM
PSMNPDGFAITRTAKPDCNYSKGRKNKNAYDLNRNFPDIFENNTLAIRQPETSAVIDWVM
SESFVLSASLHGGDVVASYPFDNIKSDGQKLPEYSKTPDDDIFIYLAKKYSYNHLIMYYG
EICVNSLEFQDGITNGAQWYVLAGGMQDFNYVWGQCLELTLELSCCKNPPEHTLEEFWEE
NRVALIEFLKQVHLGIKGQILNVDGNPIENAQVQIQGRDNIYPFETNKWGEYYRLLLPGS
YTLIVTVPGVGTILEDFELSNNETMFSAMKLNIHFSTTNITYVPSIKDDHSQWTRRV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgactttcttgtggctttgggcgatcatctcgtcagcggtagcgctgaacttcacctat
cacaacgggcggcaactggagacgtttttacgcgccatcaaccaagactacccatccatc
acgcacttgtacagcattgggaaatctgtggatggtattgatctctgggttctggcaatt
ggaaaatatccaacaaaacacactgtagggattcctgacatgaaatatgttgctaatatc
cacggtgatgaggtggttggaagagaaatgttgcttcaccttattgagcatctggttaca
atgtacggagtaaatgacaatataacagcattgataaatagcactcgagttcacatcatg
ccatccatgaatccagatggatttgcaattacacggaccgcaaaaccagattgcaattac
tctaaaggcagaaagaataaaaatgcttacgatctaaataggaacttccctgatatcttt
gaaaataatactctggcaattcgccaaccagaaacttcggcagtaatagactgggttatg
agtgaatctttcgttctgtctgcaagtttgcatggaggagatgtcgtagcaagctaccca
tttgacaacataaaatctgacggacagaagttgccagaatacagtaaaactcccgatgat
gatatcttcatatatcttgcaaagaaatattcgtataatcacctgattatgtactacgga
gaaatatgtgttaattcattagaattccaggatggaattaccaatggagctcagtggtat
gttttagcaggtggaatgcaggatttcaattatgtttggggacagtgtttggaattaaca
ctagagttatcttgttgtaaaaatccacctgaacatacactagaggaattttgggaagaa
aatcgagtggccctgattgaattcctcaaacaggttcatttaggtataaaagggcaaatt
ctgaatgttgatggaaatcctattgaaaatgcacaggtacagattcaaggcagagataac
atctacccgtttgaaactaataagtggggagaatactatagactcctgttgcctggatca
tacactttaattgttactgtgccaggagttggaacaattctggaggactttgaactttcc
aacaatgagaccatgttttctgcaatgaagctcaacattcatttcagcaccaccaatatt
acatatgtgccatctattaaagatgaccacagccaatggacgagacgtgtatag

DBGET integrated database retrieval system