KEGG   Callorhinchus milii (elephant shark): 103185740Help
Entry
103185740         CDS       T03088                                 

Gene name
fkbp10
Definition
(RefSeq) FK506 binding protein 10
  KO
K09575  FK506-binding protein 9/10 [EC:5.2.1.8]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cmk03110]
    103185740 (fkbp10)
Enzymes [BR:cmk01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103185740 (fkbp10)
Chaperones and folding catalysts [BR:cmk03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    103185740 (fkbp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 Prenyltrans
Motif
Other DBs
NCBI-GeneID: 103185740
NCBI-ProteinID: XP_007902590
Position
Un
AA seq 481 aa AA seqDB search
MDKGLLGMCVGERRRIVIPSQMAYGIKGVADIIPPNSTLYFDVVLHDVWNADDKVQSKTV
FRPEPCSRVVQNTDYVRYHYNGTLLNGTLFDSSHNRMKTYDTYVGMSLLIKGMDEGLLSM
CVGERRVITIPPFLAYGEGGYGTEIPPQASLVFHTLLVDLHNPSDTVSIQNQKVPESCSR
KTVTGDFLRYHYNGSFLDGTFFDSSYSRNHTYNTYIGMGYVISGIDQGLIGVCMGERRRV
VIPPHLGYGENGVGDKIPGSAVLVFDVHIIDFHNPSDQVEIQTYFKPTDCNRTSKLNDFI
QYHYNASLMDGEVLYTSREHGSLQSLVIGSSKMIEGLNQGVLDMCIGEKRIITIPPHLAH
GEKGLGDVPGSAVLLFDVELLDLKPGVPDGYLFVWTEDAPSNLHEELDKDKDGEIVLDEF
SSYIKAQVANGKGRLSPTESPDKLIQDMFNNQDRNSDGKISPSELKLKVDEDKEKLLKDE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggacaagggcctcctgggcatgtgtgtgggtgagagacggcgaattgtcatcccctct
cagatggcctacggcatcaagggagttgctgacatcatcccacccaactccaccctgtac
tttgatgtggttttgcacgatgtctggaacgccgatgacaaagtgcagagcaagaccgtg
ttccgacctgagccgtgcagccgagtggtgcagaacaccgactatgtccgataccattac
aacggcaccttgcttaatgggaccctcttcgactccagtcacaataggatgaagacctat
gacacctatgtggggatgagtttgctgatcaaaggaatggatgaaggtctcctcagcatg
tgtgtaggagagaggagagtcatcaccattcccccatttctggcctacggggaaggtgga
tacggcacggagatccccccacaggccagtctggtcttccacaccctgctggtggacctc
cataacccgtctgataccgtgtccatccagaaccagaaggtgccagagtcctgcagccgt
aagacggtaactggggacttcctccgctatcattacaacggcagcttcttagacggcacc
ttctttgactccagttactctcggaatcacacttacaacacctacatcgggatgggctac
gtcatcagtgggatagaccagggtttgatcggagtgtgcatgggagagagacggagagtt
gtcatccccccacatttgggttatggagagaacggtgtgggcgacaagattcctggctct
gccgtgctggtcttcgatgttcacataatcgatttccacaacccgagtgaccaggtggaa
atccaaacatacttcaagccaactgattgcaaccgcaccagcaagctgaacgacttcatc
caatatcattacaacgcctccctcatggacggcgaggtgctctacacatcgcgcgaacac
gggtctctccaaagccttgtcatcggctcctccaagatgattgaagggttaaaccaggga
gtgctggatatgtgcatcggagagaagcggattataactatcccaccgcatctggcacac
ggggagaagggattgggagacgtacctggcagtgccgtgctcttgtttgatgttgagctg
ctggatctcaagccaggggtcccggacggctatctgttcgtgtggaccgaagacgctccg
agcaacctgcacgaggagctggacaaggacaaggacggagagattgtgctggatgagttt
tccagctatataaaggctcaggtggccaatgggaagggccgcctgtcacccactgaaagc
cccgacaaactgatccaggacatgttcaacaaccaggaccgtaacagtgacggcaagatc
agccccagcgagctcaagctgaaggtcgacgaagacaaggagaagctcctgaaagacgaa
ctgtaa

DBGET integrated database retrieval system