KEGG   Callorhinchus milii (elephant shark): 103185857Help
Entry
103185857         CDS       T03088                                 

Gene name
mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
cmk04012  ErbB signaling pathway
cmk04068  FoxO signaling pathway
cmk04137  Mitophagy - animal
cmk04140  Autophagy - animal
cmk04141  Protein processing in endoplasmic reticulum
cmk04210  Apoptosis
cmk04217  Necroptosis
cmk04310  Wnt signaling pathway
cmk04510  Focal adhesion
cmk04530  Tight junction
cmk04620  Toll-like receptor signaling pathway
cmk04621  NOD-like receptor signaling pathway
cmk04622  RIG-I-like receptor signaling pathway
cmk04625  C-type lectin receptor signaling pathway
cmk04910  Insulin signaling pathway
cmk04912  GnRH signaling pathway
cmk04914  Progesterone-mediated oocyte maturation
cmk04920  Adipocytokine signaling pathway
cmk04933  AGE-RAGE signaling pathway in diabetic complications
cmk05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103185857 (mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103185857 (mapk8)
   04012 ErbB signaling pathway
    103185857 (mapk8)
   04310 Wnt signaling pathway
    103185857 (mapk8)
   04068 FoxO signaling pathway
    103185857 (mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103185857 (mapk8)
   04137 Mitophagy - animal
    103185857 (mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    103185857 (mapk8)
   04217 Necroptosis
    103185857 (mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103185857 (mapk8)
   04530 Tight junction
    103185857 (mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103185857 (mapk8)
   04621 NOD-like receptor signaling pathway
    103185857 (mapk8)
   04622 RIG-I-like receptor signaling pathway
    103185857 (mapk8)
   04625 C-type lectin receptor signaling pathway
    103185857 (mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103185857 (mapk8)
   04920 Adipocytokine signaling pathway
    103185857 (mapk8)
   04912 GnRH signaling pathway
    103185857 (mapk8)
   04914 Progesterone-mediated oocyte maturation
    103185857 (mapk8)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103185857 (mapk8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103185857 (mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmk01001]
    103185857 (mapk8)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103185857 (mapk8)
Protein kinases [BR:cmk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103185857 (mapk8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH DUF530 FTA2
Motif
Other DBs
NCBI-GeneID: 103185857
NCBI-ProteinID: XP_007902775
Position
Un
AA seq 427 aa AA seqDB search
MNRNKRDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTSF
LMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKVIEQ
LGTPASEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLCK
MLVIDAAKRISVDDALQHPYINVWYDPAEVEAPPPKICDKQLDERDHTIEEWKELIYKEV
SEWEERMKNGVIRGQPPSLGAAMINGSHHPSSSSSVNDVSSMSTDPTLASDTDSSLETSA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaaacaaacgcgacaaccagttctacagtgtagaggttggcgattccaccttt
acagtcctgaaacggtatcagaacctgaaaccaattggctcaggagcacaggggattgta
tgtgcagcctacgatgcagtccttgaccggaatgtggccatcaaaaagctcagtcgacca
tttcaaaaccaaacacatgcaaagagggcctacagagaactggtccttatgaaatgtgtc
aaccataaaaatattattggtttgctgaatgtcttcactccacaaaaatcactggaggaa
tttcaagatgtttacatagtgatggagctcatggatgccaatctctgccaggtaattcag
atggagctagaccacgaacggatgtcttatctactctatcagatgctgtgtggcatcaaa
cacctacattcagctggcattatacatagggacctgaaaccaagtaacatagtagtgaaa
gcagactgcactctgaagattctagattttggactagcaagaacagcaggaactagtttt
ctgatgacgccttatgtggttacaagatactatcgtgctccagaagtcattctaggaatg
ggatataaagagaacgttgatatctggtcagttgggtgcatcatgggagaaatgatcaga
ggtggtgtgttgttccctggtacagatcatattgatcaatggaacaaagtgatcgaacaa
ttaggaacaccggcttctgagttcatgaagaagctacagcctacagttaggacatatgtc
gaaaacagacccaagtatgcaggctacagtttcgagaaactctttccagatgtcctcttt
cctgctgactctgaacacaacaaactgaaagcaagccaagccagagatttgttatgtaaa
atgcttgtaatcgacgcagctaagaggatttctgtggacgatgctctgcagcacccctac
attaacgtttggtatgatcctgctgaggtagaggctcctccaccaaagatttgcgacaaa
caattagatgaaagggatcacaccatagaagaatggaaagagttgatatataaagaagtc
tcagagtgggaagaaagaatgaagaatggagttatacgagggcaaccaccctctttaggt
gcagcaatgatcaatggctcacatcatccatcatcatcatcatccgtcaatgatgtgtcc
tccatgtcgacagatccaaccttggcctcagataccgacagcagtctagagacatcggcg
ggacctctgggctgctgcagatga

DBGET integrated database retrieval system