KEGG   Callorhinchus milii (elephant shark): 103186198Help
Entry
103186198         CDS       T03088                                 

Gene name
rars2
Definition
(RefSeq) arginyl-tRNA synthetase 2, mitochondrial
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103186198 (rars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmk01007]
    103186198 (rars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmk03016]
    103186198 (rars2)
   03029 Mitochondrial biogenesis [BR:cmk03029]
    103186198 (rars2)
Enzymes [BR:cmk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     103186198 (rars2)
Amino acid related enzymes [BR:cmk01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   103186198 (rars2)
Transfer RNA biogenesis [BR:cmk03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103186198 (rars2)
 Prokaryotic Type
   Other AARSs
    103186198 (rars2)
Mitochondrial biogenesis [BR:cmk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    103186198 (rars2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 FaeA
Motif
Other DBs
NCBI-GeneID: 103186198
NCBI-ProteinID: XP_007903264
Position
Un
AA seq 578 aa AA seqDB search
MACLFRRSIATQLSKILGVSTEQLIPVVSAVPVSKKQQTLDFRLSVSSLLEHGCLKSGSP
IQGQAQQLAEQLTCDDVLTEIAVGQGTINFKVNRTLLAENVMNEVTKKGSSYGLSSELFN
DYPRGRIIVEFSSPNIAKRFHAGHLRSTIIGNFIANLKHALGNEVIRMNYLGDWGMQFGL
LGAGFQQFGSEEKLKSKPLEHLFDVYVQVNKMAESDENIKLAAQEFFRKLEAGDKSTLAF
WERIRCISIEEYANIYQRLGVHFDEFSGESVYQKRSHDFLRLLEKKGLLKKTKQGTGVVD
LSPNGDLSIYATVVRSDGTSLYLTRDIAAAVDRMEKYNFEKMIYVTDKGQHTHFQQVFQT
LKIMGYDWAERCQHIPFGVVQGMKTRKGDVIFLEDILNEARSRMLKNMSASKTTKELEDP
ADTAEKVGIAALIIQDFKGPLLSDYDFDWDRVLQSQGDTGVFLQYTHARLCSIQRTYENG
PQAQFNPASLQDPQAITLLQHLLRFDEVLYKASKDLQPKHLVNYLLMLSRLVSIAHRTLH
VKGSLPEVAQARFLLFKATCSVLANGMKLLGITPVEKM
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtcttttccgaaggtcgatagcaactcagctctctaaaattctgggtgtatca
acggaacagcttattccagttgtgtcagcggttcctgtctcaaagaaacagcagacactg
gactttaggctttcagtgagctctctgctagaacatggctgtctgaaatccggttcacct
atccagggtcaagcacagcaactggcagaacagttgacttgtgatgatgtactaactgaa
attgctgtgggtcaaggaaccatcaatttcaaagtgaaccgaacattgctggctgagaat
gtgatgaatgaagttaccaagaagggctcaagctatggactctcaagtgaactatttaat
gattatccccgtggacgaattatagtggaatttagttcacccaatattgcaaaacgattt
catgctggtcacttgcgttcaacaataataggtaacttcatagctaacctaaagcatgct
ttgggaaatgaagtgatcaggatgaactacctcggagactggggcatgcaatttgggttg
ctgggagccggatttcaacagtttggctcggaagagaaactgaaatccaaaccattggaa
catctttttgatgtttatgtccaagtgaacaaaatggcagagagtgatgaaaacatcaag
ttagcagcacaagagttcttcaggaaactggaggcaggggacaagtcaacactggcattt
tgggaacgaattaggtgcatcagcatcgaggaatatgcaaacatttaccagcgccttggc
gtgcacttcgatgagttctctggggaatcggtctaccagaagagatcacatgattttcta
cggctgctggaaaagaaaggactgctcaagaaaacaaagcaaggaacgggtgtcgttgat
ctttcaccgaatggtgacctgtccatttatgcaacggtggttcgaagcgatgggacttct
ctgtatttgaccagagatattgcagctgcagtggatcgaatggaaaaatacaattttgag
aaaatgatttatgtgacagataaaggtcagcacacgcatttccagcaagtttttcaaaca
ttgaaaatcatgggttatgactgggcagaacgctgtcagcacataccctttggggtagtt
caggggatgaagaccaggaagggcgatgtaatctttctagaagatattctgaatgaagct
cgctccagaatgttgaaaaacatgtctgcctcaaagacaacaaaggaacttgaagaccct
gcagatacagcagaaaaagttggcattgctgcacttattatccaggacttcaaaggtccc
cttttgtccgattatgactttgattgggatcgcgtactccaaagccagggagatactgga
gtcttcctgcaatacacacatgcaaggctctgcagtatacagagaacatatgaaaatgga
ccacaagctcaattcaacccagcttctctacaagaccctcaggcaattactttactacag
catcttctcagatttgatgaagtattgtacaaggcttctaaggatcttcaacctaagcat
cttgtcaactaccttctaatgttgagtcgtcttgtttctatagcacacaggactttgcac
gtaaagggcagtttacctgaagtagcccaggcacgatttctactgttcaaggcaacctgt
tctgtccttgccaatggaatgaaacttcttggtataactccagtcgagaagatgtga

DBGET integrated database retrieval system