KEGG   Callorhinchus milii (elephant shark): 103186634Help
Entry
103186634         CDS       T03088                                 

Gene name
kdm8
Definition
(RefSeq) lysine demethylase 8
  KO
K10277  lysine-specific demethylase 8 [EC:1.14.11.27]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmk03036]
    103186634 (kdm8)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     103186634 (kdm8)
Chromosome and associated proteins [BR:cmk03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    103186634 (kdm8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 Cupin_4 GH114_assoc JmjC
Motif
Other DBs
NCBI-GeneID: 103186634
NCBI-ProteinID: NP_001279779
UniProt: K4GIB6
Position
Un
AA seq 408 aa AA seqDB search
MSCLWPEVRALLPPRDELLGLEFSEQVEESVVYVLRQASELLYCGQDPQRCSQLGQTVLD
LSWERLNGRAWREVDKEWRRVYSLGCLVKALCLCREETDDSLSQAIAACDMGLLMGASVL
DNILLRLVQVLEPRQATGKRSLHSAGHREHTSTKRLKACAGWVPEIRAEVAVPRVSRPSL
EHFRTEYLVPQRPVILENSIEHWAALTERKWSVEYIRQVAGSRTVPVELGSRYTDEDWSQ
SLMTVDRFTADYILDQSNERPIGYLAQHQLFEQIPELKRDINIPDYCCLGEGDEDEITIN
AWFGPAGTVSPLHQDPQQNFLAQVMGRKYIRLYSPGQSERLYPHPTQLLFNTSQVDVENP
DLERFPEFGSAIFQECLLDPGEILFIPIKYWHHVRALDTSFSVSFWWH
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgcctgtggccggaggtgagagcgctgctgccgcccagagacgagttgctgggc
ctggagttcagcgagcaggtggaggagagcgtggtgtacgtgctgagacaggccagcgag
ctgctgtactgcggccaggacccccagcgctgctcacagctcggtcagacagtgctggac
ctctcctgggagagactgaatggcagggcgtggagagaggtggacaaggagtggagacga
gtgtattccctcgggtgtctggtcaaggcgctgtgtctgtgccgggaggagaccgatgac
agcctgagccaggccatcgcagcgtgtgacatgggcttgctgatgggggcgtccgtgctc
gacaacatcctgctgcggctggtgcaggtgctggagcctcgccaggctaccggcaagagg
tcactgcacagtgccggccaccgggaacacaccagcaccaagcgactgaaagcgtgtgcg
gggtgggtgcctgagatcagagctgaggtggctgtgcctcgcgtgagccggccctcactg
gaacacttccgaaccgagtacctggtcccacagaggcctgtgatcctggagaacagcatc
gagcactgggcagccctgactgagaggaaatggagcgtggagtacatccgccaggttgct
ggctctcgcactgtgcctgtggagcttggctcccgctacacagacgaggattggtctcag
agtctcatgacagtggacaggttcactgctgactacatactggatcagtcaaacgagcgc
cccattggatatctcgcccagcaccagctgtttgagcagattccagagctgaagcgggac
attaacattcccgactactgctgcctcggggagggggacgaggacgagatcaccattaat
gcctggttcgggccggcagggactgtttcccccttacaccaggatcctcagcaaaatttc
ctggctcaggtgatgggaagaaagtacattcgcttgtactcccctggccagagcgagagg
ctgtacccacacccaacacagctgctgttcaacaccagtcaggtcgatgttgagaatccg
gatttggagaggttcccggagttcggatcggccatctttcaggaatgtctcctggatcca
ggagagattttgtttatcccgatcaagtactggcatcacgtgcgggcgctggacaccagc
ttctccgtcagcttctggtggcactga

DBGET integrated database retrieval system