KEGG   Callorhinchus milii (elephant shark): 103187614Help
Entry
103187614         CDS       T03088                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00230  Purine metabolism
cmk01100  Metabolic pathways
cmk04270  Vascular smooth muscle contraction
cmk04540  Gap junction
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103187614
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103187614
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103187614
Enzymes [BR:cmk01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     103187614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB Receptor_IA-2
Motif
Other DBs
NCBI-GeneID: 103187614
NCBI-ProteinID: XP_007905380
Position
Un
AA seq 683 aa AA seqDB search
MTYQIYDDAITLRLVHEACKILGASSESILKLFGEYFFSFCKMSGYDRMLHTLGGSLMEF
IENLDALHSFLSLTYQEMNAPSFRAEKGEDGRMLLHYYSDRKGLCHIVPGIIEAVAKEFF
NSEVEMEILNQLEEEERTGKKEHVVFLVVQKKLPPQLKTQYKGKPLDHKIEKATNNMKEN
YVALPDCPVKRTHWEIVRSIVKFGKGNLLSIFQPVYPENLWIDTKAFCNTFPFHIVFDKE
LKVKQAGINIQKYVPGLQTMNVQIDNYFTVTHPEVTFTISSIRKFINSPFVLKTRREMMP
GFSKTTPMLELRGQMVWMESMQCMLYLCSPKLCSLHELEERKMHIADIALHDTTRDLILL
NQQRLAEIELSNQLERKKEELRILSKNLETEKQKTETLLYAMLPEHVAHQLKEGKKVEAG
EFKECTILFSDVVTFTNICAECEPIQIVHMLNSMYSIFDRLTTVHDVYKVETIGDSYMVV
GGVPIPVKSHAEKVANFALGMRIATRKVINPITGDPIQIRVGIHTGPVLAGVVGEKMPRY
CLFGDTVNTASRMESHGVPDKIHLSPTAYKALQHKGFKILPREEIEVKGKGKMLTYFLIH
NLHATEDAIMGSPTQGNGRDLAQPTDENIEKPDHNETNGFQSNSGPGTIAISRGENAEGA
GLDLNNKEPVHTRSTNSKLCVIL
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgacttaccaaatttatgatgatgccatcaccctcaggcttgtccatgaagcctgtaaa
attctaggtgcatcttctgaaagtattctgaaactttttggggaatatttctttagtttc
tgtaagatgtccggttatgaccggatgctacacacactgggaggatcgctgatggaattt
attgaaaatttggatgcactccacagtttcctctcactaacatatcaggaaatgaatgca
ccgtcttttcgtgcagaaaaaggagaagacggaagaatgctgcttcattactattctgac
agaaaagggctttgtcatattgttccagggataatagaagctgtagcaaaagaattcttc
aacagtgaagtggagatggaaattcttaaccaattggaagaagaagaacgcacaggaaag
aaggaacatgttgtttttctggttgtacaaaagaaacttccgccacagctaaaaacacag
tacaaaggcaaaccattggaccataagattgagaaggccacgaataacatgaaggagaac
tatgttgcattacctgattgcccagtgaagagaacacattgggaaattgtaagaagtatt
gtcaaatttggtaaaggtaacttgctgagtatctttcagccagtttatcctgagaatctt
tggatagatacaaaagctttctgcaacacatttcctttccatattgtcttcgacaaagag
ctgaaagtgaaacaggcaggaattaatattcagaagtacgtcccaggattacaaaccatg
aacgttcagattgataattatttcactgttacccacccagaagtgacatttacaattagc
agcataagaaagtttatcaacagtccatttgtcttgaaaacgcgaagagaaatgatgcct
ggattttcgaaaaccacaccaatgctggaactccgagggcaaatggtgtggatggagtcc
atgcagtgtatgctttacctgtgttcgccaaaactctgtagtctccacgaactggaggag
agaaagatgcacatcgctgacattgctctgcatgacacaacccgtgacctgatcctcctg
aatcagcagcggctggctgagattgagctctccaatcaactggagcgcaagaaagaggag
ctgaggattctgtccaagaaccttgagactgaaaaacagaaaaccgagactctgctgtat
gctatgctaccggagcatgttgctcatcagctcaaggaaggcaagaaggtagaagcagga
gagtttaaagaatgcaccatcctcttcagtgatgtagtgacttttaccaatatatgtgca
gaatgtgaacctatccaaattgttcacatgttaaactccatgtactccatatttgatcgg
ctaactactgttcatgatgtttacaaagttgaaaccattggggattcctacatggtagtt
ggaggtgttcccattcctgttaaaagccatgcagagaaagtcgctaactttgccttgggt
atgagaatcgctacccgaaaagtgatcaatccaatcactggtgaccctattcagatccga
gttggcatacacaccggaccagtgttggctggagtagttggagaaaagatgccgagatac
tgtctgtttggtgatacagttaatactgcttcaaggatggaaagccatggagtaccagac
aagatccatctcagtcctacagcatacaaagccctgcagcacaaaggctttaaaatattg
ccacgggaagaaattgaagtcaaaggcaaaggaaaaatgttaacttatttcctgatccac
aacttgcatgccactgaagatgccatcatgggtagtccaacacaaggcaatggaagagat
ttggctcagccaactgatgaaaacattgagaaacctgaccacaacgaaaccaatggattc
caaagtaacagtggcccaggtaccattgcaatttccagaggagaaaacgcagaaggagcg
ggactggacctgaacaataaggagcctgtccacacaagaagcacaaactcaaagttatgt
gttatattataa

DBGET integrated database retrieval system