KEGG   Callorhinchus milii (elephant shark): 103188244Help
Entry
103188244         CDS       T03088                                 

Gene name
gpx3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00480  Glutathione metabolism
cmk00590  Arachidonic acid metabolism
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103188244 (gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103188244 (gpx3)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103188244 (gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 103188244
NCBI-ProteinID: XP_007906360
Position
Un
AA seq 231 aa AA seqDB search
MEGSLSHWLLALLLITLVQTSQTQVSYCNSSIPDSIYNYGATTIDGRHYISFMDFMGKTV
LIVNVASYXGLTEQYLELNALHKELQPHGFTILAFPSNQFGKQEPGNNREILLSLKYVRP
GKGFVPNFLMFQKGDVNGVDEQEHYTYLKSACPPVSESFGDAHARLFWKPLKISDLKWNF
EKFLVSPTGQVIMRWNHNVPVAIVRANVIYYMKSLLERDSQLTAETERETP
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggagggcagcttgagccactggctattggctttgctcctgatcaccttggtgcaaaca
tcacagacacaggtttcttactgtaactcctcgatccccgactccatctataactatgga
gccacaacgattgacggccgtcactacatctccttcatggacttcatgggcaaaacggtg
ctgattgtcaatgtggcttcctactgagggttaaccgagcagtaccttgaactgaatgca
cttcacaaggaactgcaaccacacggttttactatcctcgccttcccctccaaccagttt
gggaaacaggagccaggcaacaatagggagatattactcagcctgaaatatgtccgccct
gggaaagggtttgtgccaaactttctgatgttccagaagggagatgtgaatggtgttgac
gaacaagagcattatacgtacctcaagagcgcgtgcccaccggtgagcgaaagcttcggg
gatgcccacgcaaggctgttctggaagcccctgaagatctcggacttgaagtggaacttt
gagaagttcctggtgagcccgaccggacaggtgatcatgcgctggaatcacaacgttcct
gtggcaatcgtcagggccaacgtcatctactacatgaaatccctgttggaaagagactcg
cagctgacagcggagacagagcgagagacaccgtga

DBGET integrated database retrieval system