KEGG   Callorhinchus milii (elephant shark): 103188536
Entry
103188536         CDS       T03088                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmk03036]
    103188536 (ankrd53)
Chromosome and associated proteins [BR:cmk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    103188536 (ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 103188536
NCBI-ProteinID: XP_007906763
UniProt: A0A4W3JIG7
Position
Un
AA seq 497 aa
MGMATRMMKPWMGLKVHQDELMAASIGDLTWLRLSLNKNKGNLATDQAGHTALHMAALHS
RLDSLRVLVEEFNMDVNQASVEGWRPIHMVISKGHQIRGLQCLKYLLSHGAQTDVQTTSG
MTALHMAANEGLLHYLMTLIEAGANVNIEDNSDHKPIDKAKIWGRRRCAKYLASVMWESN
ANDIVKEMNKLEKMKPLMLVEEKYMNDMEEEEKEYFNNEAFKWWLEKKHMRNILDKPTAF
YKKRSNAPTEWLKQRRDSLILNQSSDQLKAAQEFGIKKSRGSCRKATPPRDWIRELRRRA
HPKELDDQTTMAVVGTARKPRWNPSTNPSTHPVTKINRPVMLRTTVDPKRVLKDYNFEPF
FRLGVSKMGRPELRTYIGWQVGRMPSLPDHVIRKNLFPFTVFSRLHYPENFRSPNILTVL
RKRRPPSDRLPVSEIGLHLREVLEPEAFTAYTQTPTDKPPTPKPPTTKPPKHDLSACLVP
QPPTHTQPAVSTYCSQP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggggatggcaaccaggatgatgaagccatggatgggactgaaggttcaccaggatgag
ctgatggcggccagtatcggggacctgacttggctccggctcagcttaaacaagaacaag
ggcaacctggccacggaccaggctggccacacggcgctccacatggcggccctgcacagc
cggctggactcgctgcgggtactggtggaggagtttaacatggacgtgaaccaggccagt
gttgagggctggcggccgatacacatggtcatcagcaaaggccatcagatccggggtctc
cagtgcctcaagtacctgctcagccacggcgcccaaaccgatgtgcagacgaccagtggg
atgaccgcgctccacatggcagctaacgaggggctgctgcactatctaatgaccctgatc
gaggccggagccaatgtcaacatcgaggacaacagcgaccacaagcccatcgacaaagcc
aagatctggggtcgccgtaggtgtgccaagtatctcgccagcgtgatgtgggagagtaac
gccaatgacattgtgaaagaaatgaacaaactggagaagatgaagcctttgatgctggtg
gaagaaaagtacatgaatgacatggaagaggaggagaaggagtactttaataacgaggcc
ttcaagtggtggttggagaagaaacacatgcgtaatatcctggacaaacctactgccttc
tacaagaaacgcagcaatgcgcccacggaatggctgaaacaacgccgtgattcgctcatc
ctcaaccagagctccgaccagctcaaagccgcccaggaatttggcatcaagaagagccgg
gggtcgtgccggaaggcgacccctcctcgggactggatcagggagctgcggagacgagcg
caccccaaggagctcgacgaccagaccaccatggcagtagtgggcacggcccgcaaacca
cgctggaaccccagcaccaaccccagcacccaccccgtcaccaaaatcaaccgtccggta
atgctgagaacaaccgtggaccccaagagggtgctgaaggattataactttgagccgttt
ttccggcttggggtgagcaagatgggacgtcccgagctgcgcacatacattggctggcag
gtaggccgaatgcccagccttcctgaccacgtcatcaggaaaaacctcttccccttcaca
gtcttctcccgcctgcactaccccgagaacttccgctctcccaacatccttaccgtcctg
aggaagcgccggcccccaagcgaccgtctccccgtctctgagataggactgcacctgcgg
gaggtcctggagcccgaggccttcactgcctacacacagacccccaccgacaagcccccc
acccccaaacctcccactaccaagccccctaaacacgacctgtctgcctgcctcgtccct
cagccccccacacacacgcagcccgccgtcagcacttactgctcgcagccctga

DBGET integrated database retrieval system