KEGG   Callorhinchus milii (elephant shark): 103188590Help
Entry
103188590         CDS       T03088                                 

Gene name
sept5
Definition
(RefSeq) septin 5
  KO
K04557  septin 5
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmk04131]
    103188590 (sept5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cmk04812]
    103188590 (sept5)
Membrane trafficking [BR:cmk04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    103188590 (sept5)
Cytoskeleton proteins [BR:cmk04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     103188590 (sept5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU AAA_22 AAA_16 Roc Ras ABC_tran Dynamin_N AAA_7 AAA_24 AAA_29 NACHT G-alpha
Motif
Other DBs
NCBI-GeneID: 103188590
NCBI-ProteinID: XP_007906819
UniProt: V9KW41
Position
Un
AA seq 369 aa AA seqDB search
MVSNVRFKSRMLKSEEKEDVEKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTL
VKSLFLTDLYKDRKLLNAEERINQTVEIIKHTVDIEEKGVKLKLTIVDTPGFGDAVNNMQ
SWKPIADYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPYGHGLRPVDTEFMKALHE
KVNIVPVIAKADSLTPIEVKKLKERIRDEIELFGIKIYQFPECDSDEDDDFKQQDKELKE
SIPFAVIGSNTVVEARGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRTHMQDLKDVTW
DVHYENFRARCIQEMTSKLTQDNRAESPLPILPLPAADAETDKLIKMKDEELRRMQEMLQ
RMQQQMQDQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcaatgtcaggtttaaaagccgaatgttgaagtcggaggagaaagaggatgtg
gaaaaggaatatgtcggatttgccacgttacccaaccaggttcatcgcaaatctgtgaag
aaaggctttgacttcacattaatggtagcaggggagtctggcttagggaaatctaccctt
gtaaagagtctcttccttacagatctttataaagacaggaagcttctcaatgcagaagaa
aggatcaatcaaacggtggagattataaaacacacagtggacattgaagaaaaaggtgtt
aaactgaagctgacgatagttgacacgccgggatttggggatgctgtgaataatatgcag
agctggaaacccatcgcagattacatcgaccagcagtttgaacaatatttccgagatgag
agtggactaaaccgcaagaacattcaggacaaccgagttcactgctgcctgtatttcatt
tctccgtatggacatgggttgcggccggtcgacacagaattcatgaaggcgctacacgag
aaagtgaacattgtgccggtgatcgcgaaagctgactcgctcacacccattgaggtgaag
aaactcaaagagaggattagagatgaaattgaactgttcggaattaagatctatcaattc
ccagagtgcgactctgatgaggatgatgattttaaacagcaagacaaggagctaaaggag
agcattccctttgcagtcattggcagtaacacggtagtggaagcacggggtcagagggtt
cgtggacgactgtacccgtggggtattgtagaagtggagaaccagtcgcactgcgatttt
gttaaactgcgaaatatgctgatccgaacacacatgcaggacttaaaggacgtgacctgg
gacgttcattatgagaatttcagagccagatgtatccaggagatgactagtaaattgact
caggacaaccgagcagaaagtccacttcctatcctaccactaccagctgcagacgcagag
acggataagctgattaaaatgaaagatgaagagctgcggcgaatgcaggaaatgttgcag
cgaatgcaacagcaaatgcaggaccaatga

DBGET integrated database retrieval system