KEGG   Callorhinchus milii (elephant shark): 103189875Help
Entry
103189875         CDS       T03088                                 

Definition
(RefSeq) cytosolic phospholipase A2 zeta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00564  Glycerophospholipid metabolism
cmk00565  Ether lipid metabolism
cmk00590  Arachidonic acid metabolism
cmk00591  Linoleic acid metabolism
cmk00592  alpha-Linolenic acid metabolism
cmk01100  Metabolic pathways
cmk04010  MAPK signaling pathway
cmk04217  Necroptosis
cmk04270  Vascular smooth muscle contraction
cmk04370  VEGF signaling pathway
cmk04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103189875
   00565 Ether lipid metabolism
    103189875
   00590 Arachidonic acid metabolism
    103189875
   00591 Linoleic acid metabolism
    103189875
   00592 alpha-Linolenic acid metabolism
    103189875
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103189875
   04370 VEGF signaling pathway
    103189875
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103189875
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103189875
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103189875
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103189875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 103189875
NCBI-ProteinID: XP_007908612
Position
Un
AA seq 569 aa AA seqDB search
MGSFTVSLNLIYREEIMGGVQSTSRQHEPSVRISKELSEGEKCARRKRNNVVRHAILKLT
GKCPDKGREPTIAVLGSGGGLRATIAMLGTLQALADSDLLDCVSYLSGVSGSTWAMSQLY
SQMEWSVNMEQMVSDLRSQITEKKRTCHDSMEYLKQIGNDPTYSLTHFWGASLVYDCLGK
IETSKLSDHQVAASNGTNPYPIYAAVHGHRERHSHTTDAWFEFTPHEVGFPTPGAFVSTK
EFNHKFDAGTKIKEMNVEKDLNYLQGLWGSALADKKAIWEWIKEQLWRIVHQPQLLSSSP
ESEQSHCEHCSRKLMEILEILNEGENFEAALSKLNLDETELCGLSDHQNRSSEYYCEKLI
GNLETVNEAENKNTQVDEKRCLIPSVYMKTMRALVSWNWGENPNFAYHDSRIKELSPRGL
ELYEQEYLYLIDAGLENNCAYPLVLREERKVDLVLSFDFSAGDPFLTLTEAGKYCTANGI
PFPDLPLELDKTPHDFYVFTKPGAPTVVHFPLFNDCNCTDGSSPKTMMDKFGTQKLSYTG
YEFDELLGAASQNVSKNVGKITEQIEALL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggggagctttactgtttctctaaatctcatctatcgtgaagaaatcatgggaggcgta
caatctacttcaaggcaacatgaaccatcggtaaggatttccaaagagctctcggaaggg
gagaagtgtgcgcggaggaagcgcaacaacgtagtcagacatgccatcttgaaactgaca
gggaaatgtcctgacaagggtcgtgaacccaccatcgcagtgctgggctcggggggaggt
ctccgcgccaccatcgccatgctggggaccctccaggcgctggcggatagcgacctgctg
gactgtgtcagctacctgagcggtgtgtcaggctccacctgggctatgagccaactgtac
tcccagatggaatggtccgtaaacatggaacagatggtcagtgatctcagatcacagatc
actgagaaaaagaggacgtgtcacgattccatggagtacctcaagcagatagggaacgat
cccacgtactcactcactcacttctggggagcctcgctggtctatgactgcctgggcaag
attgagaccagcaaactgtccgatcatcaagtcgctgccagtaacgggacaaacccctac
cccatttatgctgccgttcacggacatcgagagcgacattcacacacaacagacgcctgg
ttcgagttcactcctcacgaggttggcttcccgactccgggcgctttcgtctccaccaaa
gagttcaaccacaagtttgatgccggaacgaaaataaaagagatgaatgtggagaaggat
ttaaactacttacagggtctctggggcagtgctctcgcggacaagaaagccatttgggaa
tggatcaaggaacagttgtggagaatcgtacaccaacctcaattgctgagcagttcaccg
gagtctgagcagagccactgtgaacattgctccagaaagttgatggaaattttggaaatc
ttgaacgaaggggagaattttgaggcagcgctcagcaaactcaacctggacgagacagag
ctttgcggtttgtcagatcaccagaacagatcctctgagtattactgtgaaaaattgatc
ggaaatttggaaacggtgaatgaagcggagaacaaaaacacccaagtcgatgagaagcgg
tgtctgatcccgagcgtctatatgaagacgatgagggctttggtatcctggaactggggg
gaaaatcctaacttcgcctatcatgactctcgcatcaaagaactgagtcccagaggtctg
gagctgtacgaacaggaatatctatacctgatagacgccgggctggagaataattgtgca
tatcccctggtgctcagggaagagcgtaaagtggatctcgtcctgtcatttgatttcagc
gctggtgatcccttcctgacgctgaccgaggccgggaaatactgcaccgcaaatggtatc
ccattcccagacttgcccttggagctggataaaacgcctcatgacttttatgtgttcaca
aagcctggagcacccactgtcgtgcacttcccgctattcaacgactgcaactgcacagac
gggtcaagcccgaagacgatgatggataaattcggaactcagaagttgagttacaccggg
tacgagtttgacgagttgctgggagcagcaagtcagaacgtcagtaaaaatgtggggaag
atcacagagcaaatcgaggccctgctctga

DBGET integrated database retrieval system