KEGG   Callorhinchus milii (elephant shark): 103191301
Entry
103191301         CDS       T03088                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00230  Purine metabolism
cmk00240  Pyrimidine metabolism
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103191301
   00240 Pyrimidine metabolism
    103191301
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103191301
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 CoaE Thymidylate_kin DUF5065
Other DBs
NCBI-GeneID: 103191301
NCBI-ProteinID: XP_007910479
UniProt: A0A4W3GIH9
Position
Un
AA seq 330 aa
MGPPLCGVTPPSLPHHLPQMLKTVRFLVRGSADVRPTRTPSRSGCAAVPWARGVGMGSRP
RPKRLCPAAASVQNPLHTPRLTRVAIEGNIAVGKSTFAKMLEMSTAACEVVHEPIAKWQN
IRASNHSEDSSSSALKSTGNLLQMMYEDPQRWSYTFQSYSCMSRIEAQLKPVSARLLNTE
NSVQIFERSVYSDRYIFASNMYDLGYLNETEWTIYQDWHTYLINQFGNRIALEGIIYLQA
SPEKCLERIQQRARVEEKEIQVNYLQQLHDKHEDWLVKRTMEVHFDHLKNVPMLVLDMNE
DFEEDKLKQNKLLEQVKNFMHSLRLDGRSL
NT seq 993 nt   +upstreamnt  +downstreamnt
atgggaccccctctctgcggtgtgacgccgccttccctcccgcaccacctcccgcagatg
ctgaagacggttcgctttctggtgcgcggctccgcagacgtgcggccgacccgcactccg
agccgcagcgggtgtgcggcggtcccctgggcccggggggtggggatggggtctcggccg
agacccaaacgcctgtgtccagccgccgcctctgtgcagaaccccctccacacccccaga
ctgacccgagtggccatcgaaggaaatatcgctgttggtaagtccacgtttgctaaaatg
ctggagatgtctaccgccgcgtgcgaggtggtccacgagcccatcgccaagtggcagaac
atcagggcttccaaccacagtgaggactcttcgtcctccgcactgaaaagcacgggcaac
ttgcttcagatgatgtatgaagatccccaacgatggtcctacacattccagtcctactct
tgcatgagccggatagaggcacagctaaagccagtctccgccaggctgctgaacactgag
aactcggtgcagatattcgagagatcggtgtacagtgataggtatatctttgcctctaac
atgtatgatctgggctacttgaatgaaaccgaatggactatctaccaggattggcacact
tatctgatcaaccagtttggcaacagaatagcactggaaggaattatctaccttcaagca
tctccggagaaatgcctggagcgcatccagcagagagccagggttgaggagaaggagatt
caggttaactacttacagcagctgcatgacaaacatgaagactggctggtcaaacgcacc
atggaagtccactttgaccatctgaagaatgttcccatgttggtgctggatatgaacgaa
gattttgaagaggacaagttgaaacagaacaagctcctggagcaggtgaagaacttcatg
cacagtctgcgtttggatggacgaagcctttag

DBGET integrated database retrieval system