KEGG   Callorhinchus milii (elephant shark): 103191306Help
Entry
103191306         CDS       T03088                                 

Gene name
htr4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04020  Calcium signaling pathway
cmk04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103191306 (htr4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103191306 (htr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cmk04030]
    103191306 (htr4)
G protein-coupled receptors [BR:cmk04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    103191306 (htr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 Git3
Motif
Other DBs
NCBI-GeneID: 103191306
NCBI-ProteinID: XP_007910484
Position
Un
AA seq 394 aa AA seqDB search
MWPLTLMRSYFSLAFSASKSEPHDLTGLSMLQKTVLITFLAAVMMMTVLGNLLVMVAVCK
DRQLRKIKTNYFIVSLAFADLLVSVMVMPFGAIELIENNWAYGNTFCLVRTSLDVLLTTA
SILHLCCISLDRYYAICCQPLVYSNKMTPIRVTIMLGGCWFIPLFISFLPIMKGWNSVGI
QELIEDRKFRNDTKHCVFMVNKPYAITCSVVAFYIPLVLMVLAYQRIYVTAREHVRQIDI
LKRAGASIDNGQQADQQGHHRMKTETKAAKTLCIIMGCFCLCWAPFFITNVVDPFINYSV
PDQLWTAFLWLGYINSGLNPFLYAFLNKSFRCAFLTILCCGNRRYRRASFLGQTIPSSST
AINGSTQVLRYTVLHNGLSKTIWNHSDLVSVQDS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccttaacattgatgagatcttatttctccttggcttttagtgcaagtaaaagt
gagccacatgaccttaccggattgtctatgcttcagaagacggtcctcatcacctttctt
gctgctgttatgatgatgactgttttgggaaatcttctggtgatggtggctgtctgtaag
gatcggcagctacgcaaaatcaagaccaactacttcattgtgtctctggcattcgctgac
ctgctggtgtctgtcatggtgatgccttttggagccattgagctgatagaaaataactgg
gcttacggaaatactttctgtcttgttcggacgtccttagatgtcttgttgacgacagca
tctattctccatttgtgctgcatttctctcgataggtactatgctatttgttgtcagcct
ctggtgtacagtaataaaatgactccaatccgggtgactatcatgctgggaggttgctgg
tttatcccattattcatctccttcctccctatcatgaaaggctggaatagcgttgggata
caggagttgatagaagacagaaaattcagaaacgatacaaagcattgtgtatttatggtg
aacaaaccgtatgccataacgtgttcagtggtggctttctacatacccctcgtcttaatg
gtcctcgcttatcagaggatctatgtgactgccagagaacatgtaaggcagatagacata
ctgaaacgggcaggagcctccatagacaacgggcaacaggctgaccagcaaggccaccac
agaatgaagactgaaaccaaagcagccaaaaccttgtgcattattatgggatgtttctgt
ctctgttgggccccattttttatcaccaatgtggtggacccatttataaactactctgtc
cccgaccagctgtggactgccttcctgtggctgggatatattaattcggggctcaatcca
tttctttatgcttttctcaacaaatccttcagatgtgccttcctgactattctgtgctgt
gggaacagaaggtacaggcgtgcctctttcctgggccagaccatcccttcctcttctaca
gccatcaatggatccacacaggtacttagatacaccgttttacacaatggcctctccaaa
accatatggaatcacagcgaccttgtttctgtccaggattcgtag

DBGET integrated database retrieval system