KEGG   Carnobacterium maltaromaticum: BN424_1809Help
Entry
BN424_1809        CDS       T02342                                 

Gene name
mtlD
Definition
(GenBank) mannitol dehydrogenase Rossmann domain protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml00051  Fructose and mannose metabolism
cml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN424_1809 (mtlD)
Enzymes [BR:cml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BN424_1809 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N UPF0052 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CCO11250
UniProt: K8E4B0
Position
complement(1854095..1855261)
Genome map
AA seq 388 aa AA seqDB search
MKAVHFGGGNIGRGFIGEVLSQNGFDIIFVDVNTEIINALNTFGSYKIELAAAGKEQITV
KNVSGINNQLNPEEVVAALIQADIITTAIGPNILPLIAPLIAAGIKRRFEANITTPIDVI
ACENMIGGSDYLKEEVEKHLSENEKKYLTTYIGFPNAAVDRIVPIQHHEDKLFVSVEPFK
EWVVDATTLKNEAIQLKGVQYVENLLPFIERKLFTVNTGHATTAYAGKYHGFETIEKAIK
DPTVKNQVQAVLKETGDLLITKWKFNPTEHQAYINKILSRFENPYISDEISRVARTPLRK
LGYDERFIRPIRETNDSHLKNEALIKTVAMILTYRDEKDPESIELARLIENASISEVIST
VTNLTNSDLIAIIKHNYENLAEKKSIVR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttcattttggtggaggaaatattggtagaggatttatcggtgaagtgttg
tctcaaaatggctttgacattatctttgttgatgtcaatacagaaattataaatgcttta
aatacattcggaagttataaaatagaattagctgcagctggaaaagaacaaattactgtt
aaaaatgtatctggcataaataaccaactgaatccagaagaggttgtcgcagcacttatt
caggctgatattattacaacagcaattggtcccaatattttgccgttgattgcgccattg
attgcagcaggaatcaagcgtagatttgaggcaaatataacaacaccgattgatgtgatt
gcctgtgaaaatatgattggcggtagtgactatttaaaagaagaagttgaaaaacactta
tcagaaaatgaaaaaaaatatttgactacttatatcggttttccaaatgctgcagtagac
cgaattgtaccgattcagcatcatgaagataagttatttgtttcagttgaaccttttaaa
gagtgggttgttgatgcaacaactcttaaaaatgaagcaatccaattaaaaggagttcag
tatgtagaaaacttattgccttttattgagcgtaaactattcacagtcaatacaggtcat
gcaacaacagcgtatgctgggaaatatcatggatttgaaacgattgaaaaagcaattaaa
gacccaactgtaaaaaatcaagtccaagcagtcttaaaagaaacgggagatttattgatt
accaaatggaaatttaatccaaccgagcaccaagcctatattaataaaattctttctcgt
ttcgaaaatccatatatttcagatgaaattagtcgagtagctagaacacctctccgtaaa
ttagggtacgacgaacgctttattcgcccaattcgagaaacaaatgactctcatttaaag
aatgaagcattaataaaaaccgttgcaatgattttaacctaccgggacgagaaagatcca
gaaagtatcgagttagctcgtttaattgaaaatgcatctattagtgaagtgatttctact
gtcacaaatttaacaaactcagatttaatagcaataattaaacataactatgaaaattta
gcagaaaaaaaaagcatagtgaggtaa

DBGET integrated database retrieval system