KEGG   Carnobacterium maltaromaticum: BN424_3492Help
Entry
BN424_3492        CDS       T02342                                 

Gene name
gpo
Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml00480  Glutathione metabolism
cml00590  Arachidonic acid metabolism
cml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BN424_3492 (gpo)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN424_3492 (gpo)
Enzymes [BR:cml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BN424_3492 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA DUF823
Motif
Other DBs
NCBI-ProteinID: CCO12913
UniProt: K8ELY0
Position
complement(3475590..3476069)
Genome map
AA seq 159 aa AA seqDB search
MTIYDYTATLENGETYSMEKYRGKVLVIVNTATKCGLAPQFEDLETIYETYHEKGLEVLG
FPSNQFKQELSTSEEAGEACRLTYGVTFPMHEISKVNGDDANPIFSYLVKNTSGVLGSKI
KWNFTKFLIDQEGNIVKRYAPKDSPKNMIEDINALLAKN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactatttatgattatacagcaacgctagaaaatggtgaaacctactcgatggaaaaa
tatcggggaaaagtactcgtgattgtaaacacagcaactaagtgtggattagcacctcaa
tttgaagatttagaaacaatctatgagacttaccatgaaaaaggactagaagttttaggc
tttccttctaatcaatttaaacaagaattaagtacaagcgaagaagcaggagaagcttgc
cgactgacttatggagttacttttccgatgcatgaaatttcaaaagtaaatggtgacgat
gcgaatccaattttttcttatttagttaagaatacttcaggtgttttgggaagtaaaatt
aaatggaatttcacaaaatttttaattgatcaagaaggaaatattgtaaaaagatatgca
ccaaaagatagtcctaaaaatatgattgaagatatcaatgcattgttagctaaaaattaa

DBGET integrated database retrieval system