KEGG   Carnobacterium maltaromaticum: BN424_555Help
Entry
BN424_555         CDS       T02342                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml00030  Pentose phosphate pathway
cml00480  Glutathione metabolism
cml01100  Metabolic pathways
cml01110  Biosynthesis of secondary metabolites
cml01120  Microbial metabolism in diverse environments
cml01130  Biosynthesis of antibiotics
cml01200  Carbon metabolism
Module
cml_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cml_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN424_555 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN424_555 (gnd)
Enzymes [BR:cml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BN424_555 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BN424_555 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD 3HCDH_N 2-Hacid_dh_C F420_oxidored NAD_binding_11 UDPG_MGDP_dh_N TrkA_N NAD_Gly3P_dh_N Rossmann-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CCO10045
UniProt: K8E2B1
Position
606971..607864
Genome map
AA seq 297 aa AA seqDB search
MKIGIIGLGKMGLNLAENCVDAGHKVVGFDLKPPVLNQKQKNIAIVTDLVEMIKQLPKPR
IIWSMVPSGKPTEAIFQEMNELLDTNDIFIDGGNSNYKESVVRGKKMEAKKIHFFDVGTS
GGIEGAREGGCFMIGGNQDVFKQIEPLFVDIAVENGYYYAGAVGSGHYLKMVHNGIEYGM
MQAIGEGFDLLEHAPYEFDYEKVAKVWNNGSVIRSWLMELTESAFRKDQKLEEIQGIMYS
SGEGKWTVEESLEQQVATPIITMSLMMRYRSLYPDTFSGKVVAALRNEFGGHDVEKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaattattggtttaggtaaaatgggtttaaatttagcagaaaactgcgta
gatgctggtcacaaagttgttggttttgatttgaaaccacctgtgttaaatcaaaagcaa
aaaaatattgcaatcgttactgatttagtagaaatgattaaacaattaccgaaaccacgt
attatatggtcaatggtacctagtggcaaaccaacagaagctatttttcaggaaatgaat
gaacttctggatacaaatgatatttttatagatggcggaaattcaaattataaagagtcg
gttgttcgtggcaagaaaatggaagctaaaaagattcatttctttgatgttggaacctca
ggtggtatcgaaggtgctagagaaggcggttgctttatgataggaggaaatcaagacgta
tttaaacaaattgaacctctttttgtagatatcgctgtggaaaatggctattattatgca
ggtgctgttgggagcggacattacttaaagatggttcataatggtattgagtacggtatg
atgcaagccatcggcgaaggttttgatcttttggagcatgctccatatgaatttgattat
gaaaaagttgcaaaagtttggaataacggttcggtgattcgctcgtggttgatggaatta
acggaatcagcttttagaaaagatcaaaaattagaagagattcaaggaattatgtattcg
tctggggaaggtaagtggacagttgaagaatcattggaacaacaagtggcaacacctatt
attaccatgtcgctaatgatgcgttatcgttcattatatccagatacatttagtgggaaa
gtggtagcagctttgagaaatgaatttggcggacacgatgtagaaaagaaatag

DBGET integrated database retrieval system