KEGG   Carnobacterium maltaromaticum: BN424_822Help
Entry
BN424_822         CDS       T02342                                 

Gene name
flaR
Definition
(GenBank) DNA topology modulation protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 AAA_33 Cytidylate_kin SKI AAA PduV-EutP G-alpha AAA_17 NACHT AAA_22 AAA_24 AAA_5 AAA_16 AAA_28 ABC_tran Mg_chelatase AAA_29 NB-ARC RsgA_GTPase RNA_helicase PRK AAA_PrkA NTPase_1 CPT Roc IstB_IS21 T2SSE ATP_bind_1 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CCO10286
UniProt: K8EP65
Position
883555..884082
Genome map
AA seq 175 aa AA seqDB search
MKKIIVIGPSGSGKSTLARKIAPILNLPLYHLDQLFWQAGWKSISQEAFTEKLQEIVKKE
EWIIDGNFNHSLEIRIEKADAIIFLDVPRRLYFPRIFKRYFQNYGRVRVDMSPGCVEQLD
TEFLKFVWTFSKKVRPSLIEKLKGLKPEQTLIVLRSKKEVNFFIENLPSSKSDKT
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattgtcataggaccatctggttcagggaaatcaaccctagcaagaaaa
attgctcctattctaaatctgcctttgtatcatttggatcagcttttttggcaggcaggg
tggaaatctatttctcaagaagcatttactgaaaaactacaagaaattgtaaaaaaagag
gaatggattattgatgggaattttaatcattctttagaaatccggatagaaaaagcagat
gcgattattttcttagacgttccacgccgtctttattttccacgcatttttaaacgctat
tttcaaaattatggtcgagttcgagtggatatgagtcctggatgtgtagagcaactggat
acggaatttctcaagtttgtttggacattttctaaaaaagttcgtcctagtttaattgaa
aaattaaaaggtttgaagccagaacaaactttaattgtccttcgttcgaaaaaagaagtg
aacttttttattgaaaatttacctagttctaaaagtgataaaacatag

DBGET integrated database retrieval system