KEGG   Carnobacterium maltaromaticum: BN424_828Help
Entry
BN424_828         CDS       T02342                                 

Gene name
livJ
Definition
(GenBank) receptor ligand binding region family protein
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml02010  ABC transporters
cml02024  Quorum sensing
Module
cml_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:cml00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BN424_828 (livJ)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BN424_828 (livJ)
Transporters [BR:cml02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    BN424_828 (livJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 Peripla_BP_4 Phage-Gp8 Amelin
Motif
Other DBs
NCBI-ProteinID: CCO10292
UniProt: K8E2K0
Position
888875..890020
Genome map
AA seq 381 aa AA seqDB search
MKKIVASLAVLAIMATGCGAGGGAAKDSKTIKIGANLELSGPVSAYGTAEYEGAKLAVEE
INKNGGVLGKDLELVKLDNKSDKAESASVATKLATKENVVAIVGPATSGAVKAATPSVTK
AKVPMVTPSGTDDSVTVENGKVWDYVYRVCFQDSFQGVALANFATKDLNAKKAVIIGDSS
SDYAKGLTKSFKDSFKGDIVDEVNFTTGDKDFKAVLTKIKDKNFDVLYIPSYYEEAGLII
KQARELGITQPILGADGFGNEKLVDLAQAKNLNDVYYTAHYSDKSENPKVTDFVAAFKKE
NDKTPDAFSALAYDSVYMIAKAIENAGEADPEKVKDELAKIKDFDGVTGKITMDKEHNPV
KSTLVIKLEDGKEVSNTVVEP
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatagtcgcgagtttggcagttttggcaattatggccacaggatgtggagca
ggtggaggagcagcaaaagattctaaaacaattaaaattggtgcgaatttagaattatca
ggtccagtttcggcttatggaacagctgaatatgaaggagctaagttagctgttgaggaa
atcaataaaaatggcggtgtcttaggcaaagatttggaattagttaaattagataataaa
tcagacaaggctgagtcagctagtgtagcaacaaaattagcaacaaaagagaatgtagtg
gcaattgttggaccagcaacatctggagcagttaaagctgctactccaagtgtaacaaaa
gcaaaagtaccaatggtgacaccatcaggaacagacgattctgtaactgttgaaaacgga
aaagtttgggactatgtttatcgtgtttgtttccaagattcattccaaggtgtggcactg
gcgaactttgcaaccaaggatttgaatgcgaaaaaagcggttatcattggcgatagttca
agtgattacgcaaaagggttaacaaaaagctttaaagatagctttaaaggtgacatcgta
gatgaagtcaattttacaactggagataaagattttaaagcggtcttaactaaaattaaa
gacaaaaacttcgatgttttgtatattccttcttattatgaagaagctggtttaatcatt
aaacaagcaagagaattaggtattacacaacctatcttgggagctgatggttttggcaat
gaaaaattagttgatttggctcaagctaaaaatctaaatgatgtttattatacagcacat
tattcagataagagtgagaaccctaaagttactgactttgttgcagcctttaaaaaagaa
aatgacaagacaccagatgctttctcagcattagcttatgattcagtttatatgattgca
aaagcaattgaaaatgctggcgaagcagatccagaaaaagtaaaagatgaattagctaaa
attaaagactttgatggcgtaacaggtaaaattacaatggataaagaacacaacccagta
aaatcaaccttagttatcaaattagaagatggtaaagaagttagcaatacggttgtagag
ccttaa

DBGET integrated database retrieval system