KEGG   Carnobacterium maltaromaticum: BN424_829Help
Entry
BN424_829         CDS       T02342                                 

Gene name
livH
Definition
(GenBank) branched-chain amino acid transport system / permease component family protein
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml02010  ABC transporters
cml02024  Quorum sensing
Module
cml_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:cml00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BN424_829 (livH)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BN424_829 (livH)
Transporters [BR:cml02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    BN424_829 (livH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 FecCD
Motif
Other DBs
NCBI-ProteinID: CCO10293
UniProt: K8EES0
Position
890105..890983
Genome map
AA seq 292 aa AA seqDB search
MENFIQQLINGLSLGSIYALIALGYTMVYGIIKLINFAHGEVYMVGSYVGYTVIRNFNLG
LIPALLFSMVFCAILGVVVERVAYKPLRKATRVAALITAIGVSFLLQYIVLFIMGPEVKA
FPETLQNKSYSLGGITIDEQQITIFVVTIVLMLALQFIVKKTKMGKAMRAVSVDADAAKL
MGINVDNTISFTFALGSALAGAAGVLVGIYYNSISPMMGTAPGLKAFIAAVLGGIGLIPG
AMFGGFTIGIIETLISGYGNSMIKDAVVYGILIVILIVKPSGLLGKNTKEKV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttattcagcaattgattaatggtctgtcattaggcagtatttatgcattg
attgccctaggttacacaatggtttatgggattatcaagttaattaactttgcccacgga
gaagtttatatggtgggatcgtacgttggatatacagtgattcgtaattttaatttagga
cttattccagcattacttttttcaatggtattttgtgctattttgggagtagtcgttgaa
cgagtagcatacaaacctttgcgtaaagccacgcgagtagctgctttaattacagcaata
ggggtttctttcttattacaatatattgtactgtttattatgggacctgaagtgaaggct
tttcccgaaacattacaaaataaaagttattcattaggtggtattacaattgatgagcaa
caaattactatttttgtcgtaacaattgtgttgatgttagctttacaattcattgtgaaa
aaaaccaaaatggggaaagcaatgcgtgctgttagtgttgatgcagatgctgcaaaatta
atggggattaatgtagataacacgatttcattcacttttgctttaggttcagctttagct
ggtgcggcaggagttttagtaggaatttattacaattcaatttcaccaatgatgggaact
gctccagggctaaaagcatttattgcggctgttttaggtggcattggcctaatcccaggt
gccatgtttggtggatttacgattgggattattgaaacattgatcagtggctacggaaat
tcaatgattaaagatgctgttgtatatggaatcttaattgtgattttaattgttaagcca
tctggtttattaggcaaaaatactaaagaaaaagtgtag

DBGET integrated database retrieval system